KEGG   Mus musculus (mouse): 14465
Entry
14465             CDS       T01002                                 

Gene name
Gata6, AA410133, GATA-6
Definition
(RefSeq) GATA binding protein 6
  KO
K17897  GATA-binding protein 6
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    14465 (Gata6)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    14465 (Gata6)
SSDB
Motif
Pfam: GATA-N GATA TF_Zn_Ribbon PHC2_SAM_assoc Prim_Zn_Ribbon
Other DBs
NCBI-GeneID: 14465
NCBI-ProteinID: NP_034388
MGI: 107516
Ensembl: ENSMUSG00000005836
UniProt: Q61169
Position
18 A1; 18 5.63 cM
AA seq 589 aa
MALTDGGWCLPKRFGAAAADAGDSGPFPAREPSSPLSPISSSSSSCSRGGDRGPCGASNC
RTPQLDAEAVAGPPGRSLLLSPYASHPFAAAHGAAAPGVAGPGSALSTWEDLLLFTDLDQ
AATASKLLWSSRGAKLSPFAAEQPEEMYQTLAALSSQGPAAYDGAPGGFVHSAAAAAAAA
AAASSPVYVPTTRVGSMLSGLPYLQGAGSGPSNHAGGAGAHPGWSQASADSPPYGGGGAA
GGGAAGPGGAGSATAHASARFPYSPSPPMANGAARDPGGYVAAGGTGAGSVSGGGGSLAA
MGGREHQYSSLSAARPLNGTYHHHHHHHPTYSPYMAAPLTPAWPAGPFETPVLHSLQGRA
GAPLPVPRGPSTDLLEDLSESRECVNCGSIQTPLWRRDGTGHYLCNACGLYSKMNGLSRP
LIKPQKRVPSSRRLGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKE
GIQTRKRKPKNINKSKACSGNSSGSVPMTPTSSSSNSDDCTKNTSPSTQATTSGVGASVM
SAVGENANPENSDLKYSGQDGLYIGVSLSSPAEVTSSVRQDSWCALALA
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggccttgactgacggcggctggtgcctgccaaagcgtttcggggctgctgctgcggac
gccggcgactccgggccctttccagcgcgggagccctcctcgccgctttcccccatctcg
tcttcgtcctcctcctgctcccggggcggggatcgcggtccctgcggcgccagcaactgc
aggacgccgcagctcgacgccgaggcggtggcgggacctccgggccgctcgctcttgctc
agcccctacgcctcgcatcccttcgccgctgcccacggagccgcggcgcccggggtcgca
ggccccgggagcgccctgtcgacttgggaggacctgttgctcttcactgacctcgatcag
gccgcgaccgccagcaagctgttgtggtccagccggggcgccaaactgagccccttcgcg
gccgagcagccggaggaaatgtaccagaccctcgccgccctgtccagccaggggcccgcc
gcttacgacggcgcgcccggcggcttcgtgcactccgcagcggcggcggccgctgccgcc
gcggcagccagctccccggtctacgtgcccaccacgcgcgtgggctccatgctgtccggc
ctgccctaccttcaaggggcgggcagcgggcccagcaatcacgcgggcggagcgggtgcc
cacccaggctggtcccaggcctccgccgacagccccccgtatggcgggggtggcgcagcc
ggcggcggcgcggccggacctggaggtgcgggatcggctacggcccacgcctctgcacgc
tttccctactcgcccagcccgcccatggccaacggcgccgcgcgagaccccgggggctac
gtggctgcgggcggcacgggcgcaggcagtgtgagtggaggtggcggcagcctggcggcc
atgggtggccgggagcaccagtacagctcgctgtccgcagctcggccgctgaacggaacg
taccaccaccaccatcaccatcacccgacctactcgccctacatggccgcaccgctgact
cctgcctggccagcaggacccttcgaaacgccggtgctccacagcttacagggccgcgcg
ggagctccactcccggtgccacggggccccagcacagacctgttggaggacctgtcggag
agccgcgagtgcgtgaactgcggctccatccagacgccactgtggagacgagacggcacc
ggtcattacctgtgcaatgcatgcggtctctacagcaagatgaatggcctcagcaggccc
ctcatcaagccacagaagcgcgtgccttcatcacggcggcttggactgtcctgtgccaac
tgtcacaccacaaccactaccttatggcgtagaaatgctgagggtgagcctgtgtgcaat
gcttgcgggctctatatgaaactccatggggtgcctcgaccacttgctatgaaaaaagaa
ggaattcaaaccaggaaacgaaaacctaaaaatataaataagtcaaaagcttgctccggt
aacagcagtggctctgtccctatgactcctacttcctcttcttctaattcagatgactgc
accaaaaatacttctccttctacacaagcgaccacctcaggggtaggggcatcagtgatg
tctgcagtgggagaaaacgccaaccccgagaacagtgacctcaagtattcaggtcaagac
ggcctctacataggtgtcagtctgtcctcccctgccgaagtcacatcctccgtgcgacag
gattcttggtgtgctctggccctggcctga

DBGET integrated database retrieval system