KEGG   Mus musculus (house mouse): 14472
Entry
14472             CDS       T01002                                 
Symbol
Gbx2, D130058E05Rik, Gbx-2, MMoxA, Stra7
Name
(RefSeq) gastrulation brain homeobox 2
  KO
K09321  homeobox protein GBX
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    14472 (Gbx2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: HOXL
    14472 (Gbx2)
SSDB
Motif
Pfam: Homeodomain
Other DBs
NCBI-GeneID: 14472
NCBI-ProteinID: NP_034392
MGI: 95668
Ensembl: ENSMUSG00000034486
UniProt: P48031
Position
1:complement(89855684..89858898)
AA seq 348 aa
MSAAFPPSLMMMQRPLGSSTAFSIDSLIGSPPQPSPGHFVYTGYPMFMPYRPVVLPPPPP
PPPALPQAALQPALPPAHPHHQIPSLPTGFCSSLAQGMALTSTLMATLPGGFSASPQHQE
AAAARKFAPQPLPGGGNFDKAEALQADAEDGKAFLAKEGSLLAFSAAEAVQASLVGAVRG
QGKDESKVEDDPKGKEESFSLESDVDYSSDDNLPGQTAHKEEDPGHALEETPQSGGAAGS
TTSTGKNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRA
KWKRVKAGNANSKTGEPSRNPKIVVPIPVHVSRFAIRSQHQQLEQARP
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgagcgcagcgttcccgccgtcgctgatgatgatgcagcgcccgctggggagtagtacc
gccttcagcatagactcgctgatcggcagcccgccgcagcccagtcccggccatttcgtc
tacaccggctaccccatgttcatgccctaccggccggtggtgctgccgccaccgccgcca
ccgcctcccgcgctgccccaggcagcgctgcagcccgctctgccgcccgcgcaccctcac
caccagatccccagcctgcccaccggcttctgctccagcctggcgcagggcatggcgctc
acctccacgctcatggccactctgcccggcggcttctctgcgtcgccccagcaccaagag
gcggcggctgcccgcaagttcgctccacagccactgcccggaggcggcaacttcgacaaa
gccgaggcgctccaagcggatgcggaagacggcaaagccttcttggccaaggagggctcg
ctgctcgctttctctgcggccgaagcggtgcaggcgtcgctcgtcggggctgtccgaggg
caagggaaagacgagtcaaaggtggaagatgacccgaagggcaaggaggagagcttctct
ctggagagcgatgtggattacagctcagatgacaatttgcctggtcagactgctcataag
gaagaagaccccggccacgcactggaggagaccccgcagagcggcggtgcagcaggcagc
accacgtccacaggcaagaaccggcggcggcggactgccttcaccagcgaacagctgctg
gagctggagaaagaattccactgcaaaaagtacctctccctgaccgagcgctcacagatc
gcccacgccctcaaactcagcgaggtgcaagtaaaaatctggttccagaaccgccgggcc
aagtggaaacgtgtcaaggcaggcaacgccaattccaagacgggggagccctctcggaac
cccaagattgtcgtccccatccctgttcacgttagcaggttcgctattcgaagtcaacac
cagcagctggagcaggcccgaccctga

DBGET integrated database retrieval system