KEGG   Mus musculus (mouse): 14479
Entry
14479             CDS       T01002                                 

Gene name
Usp15, 4921514G19Rik, AI327321, E430033I05Rik, Gcap, Gcap18
Definition
(RefSeq) ubiquitin specific peptidase 15
  KO
K21343  ubiquitin carboxyl-terminal hydrolase 15 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    14479 (Usp15)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    14479 (Usp15)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    14479 (Usp15)
   04121 Ubiquitin system [BR:mmu04121]
    14479 (Usp15)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     14479 (Usp15)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   14479 (Usp15)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    14479 (Usp15)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    14479 (Usp15)
SSDB
Motif
Pfam: UCH Ubiquitin_3 DUSP UCH_1 USP7_C2 USP7_ICP0_bdg Choline_bind_1
Other DBs
NCBI-GeneID: 14479
NCBI-ProteinID: NP_081880
MGI: 101857
Ensembl: ENSMUSG00000020124
UniProt: Q8R5H1 Q3TSV9
Position
10; 10 D2
AA seq 981 aa
MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNV
YPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQ
GMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFNIPDEKEARLW
NKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGPSTPKSPGASNFSTLPK
ISPSSLSNNYNNINNRNVKNSNYCLPSYTAYKNYDYSEPGRNNEQPGLCGLSNLGNTCFM
NSAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQMWSGKFSYVTPR
AFKTQVGRFAPQFSGYQQQDCQELLAFLLDGLHEDLNRIRKKPYIQLKDADGRPDKVVAE
EAWENHLKRNDSIIVDIFHGLFKSTLVCPECAKISVTFDPFCYLTLPLPMKKERSLEVYL
VRMDPLAKPMQYKVIVPKIGNILDLCTALSALSGVPADKMIVTDIYNHRFHRIFAVDENL
SSIMERDDIYVFEININRAEDTEHVVIPVCLREKFRHSSYTHHTGSSLFGQPFLMAIPRN
NTEDKLYNLLLLRMCRYVKMSTETEETDGHLRCCEDQNINGNGPNGLHEEGSPSEMETDE
PDDESSQDQELPSENENSQSEDSVGGDNDSENGLCTEETCKGQLTGHKKRLFTFQFNNLG
NNDINYIKDDTSHIRFDDRQLRLDERSFLALDWDPDLKKRYFDENAAEDFEKHESVEYKP
PKRPFVKLKDCIELFTTKEKLGAEDPWYCPNCKEHQQATKKLDLWSLPPVLVVHLKRFSY
SRYMRDKLDTLVDFPISDLDMSEFLINPNAGPCRYNLIAVSNHYGGMGGGHYTAFAKNKD
DGKWYYFDDSSVSTASEDQIVSKAAYVLFYQRQDTFSGTGFFPLDRETKGASAATGIPLE
SDEDSNDNDNDLENENCMHTN
NT seq 2946 nt   +upstreamnt  +downstreamnt
atggcggaaggcggagcggcggacctggacacccagcgttctgacatcgcgacgctgctc
aaaacctcgctccggaaaggggacacctggtatctagtagatagtcggtggttcaaacag
tggaaaaaatatgttggctttgacagctgggacaaataccagatgggagatcaaaatgtc
tatcctggacccatcgataactctggacttctcaaagatggcgacgcgcagtcacttaag
gagcaccttattgatgagttggattacatactcttgccaactgagggctggaataaactt
gtcagctggtacacactgatggagggccaggagccaatagcaagaaaggtggtagaacag
ggtatgtttgtaaagcactgcaaagtagaagtctacctcacagaactgaagctctgtgag
aacgggaacatgaacaatgttgtaactcggaggtttagcaaagctgacacaatagatacg
attgagaaggaaataagaaaaatcttcaatattccagatgagaaggaggccagactgtgg
aacaagtatatgagcaacacatttgaaccactgaataagccagacagcaccatccaggat
gccggcctataccaaggacaggtgttagtgatagagcaaaaaaatgaagatggaacgtgg
cccaggggtccctctactcctaagtccccaggtgcatccaatttttcaactttaccaaag
atctctccttcatctctatcaaataattataacaacatcaacaacagaaatgtgaaaaac
tcaaattattgtctcccgtcatatactgcttataagaactatgattattcagaacctgga
agaaacaatgaacagccaggcctgtgtggcttaagtaacttgggaaatacgtgtttcatg
aactcagccattcagtgtttgagcaacacacctccacttactgaatatttcctcaatgat
aagtaccaagaagagctgaattttgacaatcccttaggaatgagaggtgaaatagctaaa
tcatacgctgaactcatcaagcagatgtggtctggaaagtttagctacgtcactccaaga
gcattcaagacacaggtagggcgcttcgcacctcagttctctggatatcaacagcaggac
tgccaagaactactggctttcctgttggatggactgcacgaggacctgaatagaattagg
aaaaaaccctatatccagttaaaagatgctgatggcaggccagacaaggtggttgctgaa
gaagcctgggagaaccatttaaagcgaaatgattccatcatagtagacatattccatggc
cttttcaagtctacgttagtgtgtcctgagtgtgctaagatctcggtgacctttgaccct
ttctgttacttgactcttccattgcctatgaaaaaagaacgtagcttggaagtttattta
gttagaatggatccacttgctaaacctatgcaatacaaagttattgtgcccaaaattgga
aatatactagatctttgtacagcgctgtctgctttgtcgggagtacctgcagataagatg
atagtcactgacatatacaatcatagatttcacaggatatttgccgtggatgaaaacctg
agtagtattatggagcgggatgatatttacgtgtttgaaattaacatcaacagggcagaa
gacacagagcatgtagttatccctgtctgcctaagagaaaaattcagacactcaagttac
actcaccacactggctcttcactgttcggccagccttttcttatggctataccacgaaac
aatactgaagataaactctataatcttctactcttgagaatgtgccggtatgtcaaaatg
tctactgaaactgaggaaacagatggacacctacgttgctgtgaggaccagaatattaat
gggaatgggccaaatggcctacatgaagagggttcaccaagtgagatggaaaccgacgag
ccagatgacgagtccagccaggatcaagagcttccctcagagaacgagaacagtcagtct
gaagattcagtcggaggagataacgattctgaaaatggattgtgcactgaagaaacatgc
aaaggtcaacttacgggacacaaaaagcgcttgtttacattccagttcaacaacttaggc
aacaatgacatcaactacatcaaagacgacaccagtcacatccgattcgatgacaggcag
cttcggctggacgaaagatcttttctcgctttggactgggaccctgacttgaagaagaga
tactttgatgagaatgctgcagaggattttgaaaaacatgaaagtgtggaatacaaacct
ccaaaaaggccctttgtgaagttaaaagactgcattgagctcttcaccaccaaggagaag
ctgggtgctgaggacccctggtattgtccaaattgtaaagagcatcagcaagccacaaag
aaattagatctgtggtccctgcctccagttcttgtggtgcatctcaagagattctcctat
agtcgctacatgagagacaagctagatacattagtcgattttcccatcagtgacttggat
atgtcagaattcctaattaacccaaatgcaggtccttgccgctataatttgattgctgtt
tccaaccactatggagggatgggaggaggacattatactgcttttgcaaaaaacaaagat
gatgggaagtggtactatttcgatgacagtagcgtctccactgcatctgaagaccaaatc
gtgtccaaggcagcgtacgtgctcttctaccagagacaggacactttcagtgggactggc
ttcttccctcttgaccgagaaactaaaggtgcttcagctgccacaggtatccccctggaa
agtgacgaagacagcaatgataatgacaatgacctagaaaatgaaaactgtatgcacact
aattaa

DBGET integrated database retrieval system