KEGG   Mus musculus (mouse): 14489Help
Entry
14489             CDS       T01002                                 

Gene name
Mtpn, 5033418D15Rik, Gcdp, V1
Definition
(RefSeq) myotrophin
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_4 Ank_5 Ank_2 Ank_3 Ank DUF655
Motif
Other DBs
NCBI-GeneID: 14489
NCBI-ProteinID: NP_032124
MGI: 99445
Ensembl: ENSMUSG00000029840
Vega: OTTMUSG00000024162
UniProt: P62774
Structure
PDB: 

Position
6; 6 B1
AA seq 118 aa AA seqDB search
MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGAD
INAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTALEATDNQAIKALLQ
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgacaaggagttcatgtgggccctgaaaaacggagacttggatgaggtgaaggac
tatgtggctaagggagaagatgtcaaccggacactagagggtggaaggaagcctcttcat
tatgctgcagattgtggacagcttgaaatcctggaatttctgctgctgaaaggagcagat
attaatgctccagataaacatcatattacccctcttctgtctgctgtctatgagggtcat
gtttcctgcgtgaaattgcttctgtcaaagggtgctgataagactgtgaaaggcccagat
ggactgaccgcccttgaagccactgacaaccaggcaatcaaagctcttctccagtga

DBGET integrated database retrieval system