KEGG   Mus musculus (mouse): 14534Help
Entry
14534             CDS       T01002                                 

Gene name
Kat2a, 1110051E14Rik, AW212720, Gcn5, Gcn5l2, mmGCN5
Definition
(RefSeq) K(lysine) acetyltransferase 2A
  KO
K06062  histone acetyltransferase [EC:2.3.1.48]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04330  Notch signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu05166  Human T-cell leukemia virus 1 infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    14534 (Kat2a)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    14534 (Kat2a)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    14534 (Kat2a)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    14534 (Kat2a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    14534 (Kat2a)
   03036 Chromosome and associated proteins [BR:mmu03036]
    14534 (Kat2a)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     14534 (Kat2a)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     14534 (Kat2a)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    14534 (Kat2a)
   HAT complexes
    PCAF complex
     14534 (Kat2a)
    STAGA complex
     14534 (Kat2a)
    TFTC complex
     14534 (Kat2a)
    SAGA complex
     14534 (Kat2a)
    SLIK complex
     14534 (Kat2a)
    ADA-HAT complex
     14534 (Kat2a)
    HAT-A2 complex
     14534 (Kat2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCAF_N Bromodomain Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 T2SSM
Motif
Other DBs
NCBI-GeneID: 14534
NCBI-ProteinID: NP_064388
MGI: 1343101
Ensembl: ENSMUSG00000020918
Vega: OTTMUSG00000002053
UniProt: Q9JHD2 Q6P3Z8
Position
11 D; 11 63.53 cM
AA seq 830 aa AA seqDB search
MAEPSQAPNPVPAAQPRPLHSPAPAPTSTPAPSPASASTPAPTPAPAPAPAAAPAGSTGS
GGAGVGSGGDPARPGLSQQQRASQRKAQVRGLPRAKKLEKLGVFSACKANETCKCNGWKN
PKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVENLFMS
VHKEEDTDTKQVYFYLFKLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSH
LAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQSEDVATYKVNYTRWLCYCHVPQSC
DSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEE
EIYGANSPIWESGFTMPPSEGTQLVPRPATVSATVVPSFSPSMGGGSNSSLSLDSAGTEP
MPAGEKRKLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARD
ETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPK
HKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHSI
LYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHI
IKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKEL
KDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYY
VTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaccttcccaggccccaaacccggtcccggcagcgcagccccggccccttcac
tccccagcccctgccccaacttcgactcctgcgcccagtccggcttcagcctccactccg
gctccgactccggcaccagcccctgccccagctgcagccccagctgggagcacagggagt
gggggcgccggggtaggaagtgggggggatccggctcgacctggcctgagccagcagcag
cgcgctagccagaggaaggcgcaagtccggggtctgccgcgtgccaagaagcttgagaaa
ctaggggtcttctcagcttgcaaggccaatgaaacctgcaagtgtaatggctggaaaaac
cccaagccccccaccgcaccccgcatggacctccagcagccagctgccaacctgagcgag
ttgtgccgtagctgtgagcaccctttggcggaccatgtgtcccacctggagaatgtgtca
gaggacgagattaaccggctcttgggaatggtagtagatgtagaaaatctgttcatgtct
gttcacaaggaagaggacacagacaccaaacaagtctatttctacctcttcaagctcttg
cggaagtgcattctgcagatgacacggccagtggtggaggggtctctaggcagcccccca
tttgagaagcctaacattgaacagggtgtactgaactttgtgcagtacaaatttagccac
ctggccccccgagagcgccagacaatgtttgagctctcaaagatgttcctgctctgcctt
aactactggaagctggagacccctgctcaattccggcagcggtcccagtctgaggatgtc
gctacctacaaagtcaattataccagatggctctgttactgccacgtgccccagagctgc
gacagcctcccccgctacgagaccacccacgtgtttggccgaagccttctacggtccatt
ttcactgtcacccgccggcagctactggaaaaatttcgggtggaaaaggacaaactggtg
cctgagaagaggaccctcatcctcactcacttccccaaattcctgtccatgcttgaggaa
gagatctacggggcaaattctcccatctgggagtcaggcttcaccatgccaccttcggag
gggacacagctggtgccccggccagccacggtcagtgcaacagttgtacccagcttcagt
ccttccatgggaggaggcagcaacagctccctgagcctagattccgcagggactgagccc
atgccagcaggggagaagaggaagcttcctgagaacctgaccctggaggatgccaagcgg
ctccgcgtgatgggggacatccccatggagctggtcaatgaggtcatgctgacgatcact
gaccccgctgccatgctggggcctgagacaagcctgctttcggccaacgcagctcgagat
gagacggctcgcctggaagaacggcgaggaatcatcgagttccacgtcattggcaactcc
ctgacgcccaaggccaaccggcgcgtgctgctctggctcgtggggctgcagaatgtcttt
tcccaccagctgccaagaatgcccaaggaatatatcgcccgcctcgtctttgacccgaag
cacaagaccctggccctgatcaaggatgggcgggtcatcggtggcatttgcttccgcatg
tttcccactcagggcttcacggaaatcgtcttctgtgccgtcacctcaaatgagcaggtc
aagggctatggcacccacctgatgaaccacctaaaggagtaccacatcaaacacagcatc
ctttactttctcacctatgctgacgagtacgccattggctacttcaaaaagcagggcttc
tccaaagacatcaaggtgcccaagagccgctatctgggctacatcaaggactatgaagga
gcgacgctgatggagtgtgagctgaatccccgaatcccctacacagagctgtcccacatc
atcaagaaacagaaagagatcatcaagaagttgattgagcgcaaacaggcacagatccgc
aaggtctaccctggactcagctgcttcaaagagggagtgaggcagatcccggtggagagc
gtccctggcattcgagagacaggctggaagccactgggaaaggagaagggcaaggagctt
aaggatcctgatcagctatatacgaccctcaaaaacctgctggctcagatcaagtcacac
cccagtgcctggcccttcatggaacctgtgaagaagtcagaggctcctgactactacgag
gttatccgtttccccattgacctgaagaccatgacagaacggttgcgcagtcgctactat
gtgacccggaagctcttcgtagctgacctgcagcgggtcatcgccaactgccgggagtac
aatcccccagacagcgaatactgtcgctgcgccagtgccctggagaagttcttctacttc
aagctcaaagagggagggctcatcgacaagtag

DBGET integrated database retrieval system