KEGG   Mus musculus (mouse): 14536
Entry
14536             CDS       T01002                                 

Gene name
Nr6a1, 1700113M01Rik, Gcnf, NCNF, RTR
Definition
(RefSeq) nuclear receptor subfamily 6, group A, member 1
  KO
K08561  germ cell nuclear factor
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    14536 (Nr6a1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mmu03310]
    14536 (Nr6a1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 germ cell nuclear factor
    14536 (Nr6a1)
Nuclear receptors [BR:mmu03310]
 6. Germ cell nuclear factor
  6A. Germ cell nuclear factor receptor
   14536 (Nr6a1)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 14536
NCBI-ProteinID: NP_034394
MGI: 1352459
Ensembl: ENSMUSG00000063972
Vega: OTTMUSG00000012347
UniProt: Q64249
Structure
PDB: 
5KRB

Position
2; 2 B
AA seq 495 aa
MERDERPPSGGGGGGGSAGFLEPPAALPPPPRNGFCQDELAELDPGTNGETDSLTLGQGH
IPVSVPDDRAEQRTCLICGDRATGLHYGIISCEGCKGFFKRSICNKRVYRCSRDKNCVMS
RKQRNRCQYCRLLKCLQMGMNRKAIREDGMPGGRNKSIGPVQISEEEIERIMSGQEFEEE
ANHWSNHGDSDHSSPGNRASESNQPSPGSTLSSSRSVELNGFMAFRDQYMGMSVPPHYQY
IPHLFSYSGHSPLLPPQARSLDPQSYSLIHQLMSAEDLEPLGTPMLIEDGYAVTQAELFA
LLCRLADELLFRQIAWIKKLPFFCELSIKDYTCLLSSTWQELILLSSLTVYSKQIFGELA
DVTAKYSPSDEELHRFSDEGMEVIERLIYLYHKFHQLKVSNEEYACMKAINFLNQDIRGL
TSASQLEQLNKRYWYICQDFTEYKYTHQPNRFPDLMMCLPEIRYIAGKMVNVPLEQLPLL
FKVVLHSCKTSTVKE
NT seq 1488 nt   +upstreamnt  +downstreamnt
atggagcgggacgaacggccacctagcggagggggaggcggcgggggctcggcggggttc
ctggagccgcccgccgcgctccctccgccgccgcgcaacggtttctgtcaggatgaattg
gcagagcttgatccaggcactaatggagagactgacagtttaacacttggccaaggccat
atacctgtttccgtcccagatgatcgagctgaacaacgaacctgtctcatctgtggggac
cgcgctacgggcttgcactatgggatcatctcctgcgagggctgcaaggggtttttcaag
aggagcatttgcaacaaacgggtgtatcggtgcagtcgtgacaagaactgtgtcatgtcc
cggaagcagaggaacagatgtcagtactgccgcctgctcaagtgtctccagatgggcatg
aacaggaaggctatcagagaagatggcatgcctggaggccggaacaagagcattggacca
gtccagatatcagaagaagaaattgaaagaatcatgtctggacaggagtttgaggaagaa
gccaatcactggagcaaccatggtgacagcgaccacagttcccctgggaacagggcttca
gagagcaaccagccctcaccaggctccacactatcatccagtaggtctgtggaactaaat
ggattcatggcattcagggatcagtacatggggatgtcagtgcctccacattatcaatac
ataccacacctttttagctattctggccactcaccacttttgcccccacaagctcgaagc
ctggaccctcagtcctacagtctgattcatcagctgatgtcagccgaagacctggagcca
ttgggcacacctatgttgattgaagatgggtatgctgtgacacaggcagaactgtttgct
ctgctttgccgcctggccgacgagttgctctttaggcagattgcctggatcaagaagctg
cctttcttctgcgagctctcaatcaaggattacacgtgcctcttgagctctacgtggcag
gagttaatcctgctctcctccctcacagtgtacagcaagcagatctttggggagctggct
gatgtcacagccaagtactcaccctctgatgaagaactccacagatttagtgatgaaggg
atggaggtgattgaacgactcatctacctatatcacaagttccatcagctgaaggtcagc
aacgaggagtacgcatgcatgaaagcaattaacttcctgaatcaagatatcaggggtctg
accagtgcctcacagctggaacaactgaacaagcggtattggtacatttgtcaggatttc
actgaatataaatacacacatcagccaaaccgctttcctgatcttatgatgtgcttgcca
gagatccgatacatcgcaggcaagatggtgaatgtgcccctggagcagctgcccctcctc
tttaaggtggtgctgcactcctgcaagacaagtacggtgaaggagtga

DBGET integrated database retrieval system