KEGG   Mus musculus (mouse): 14544
Entry
14544             CDS       T01002                                 

Gene name
Gda, AU015411, AW047581, GAH
Definition
(RefSeq) guanine deaminase
  KO
K01487  guanine deaminase [EC:3.5.4.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    14544 (Gda)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.3  guanine deaminase
     14544 (Gda)
SSDB
Motif
Pfam: Amidohydro_1 Amidohydro_3
Other DBs
NCBI-GeneID: 14544
NCBI-ProteinID: NP_034396
MGI: 95678
Ensembl: ENSMUSG00000058624
Vega: OTTMUSG00000028318
UniProt: Q9R111 Q548F2
Position
19 B; 19 14.32 cM
AA seq 454 aa
MCAARTPPLALVFRGTFVHSTWTCPMEVLRDHLLGVSDSGKIVFLEESSQQEKLAKEWCF
KPCEIRELSHHEFFMPGLVDTHIHAPQYAFAGSNVDLPLLEWLNKYTFPTEQRFRSTDVA
EEVYTRVVRRTLKNGTTTACYFGTIHTDSSLILAEITDKFGQRAFVGKVCMDLNDTVPEY
KETTEESVKETERFVSEMLQKNYPRVKPIVTPRFTLSCTETLMSELGNIAKTHDLYIQSH
ISENREEIEAVKSLYPSYKNYTDVYDKNNLLTNKTVMAHGCYLSEEELNIFSERGASIAH
CPNSNLSLSSGLLNVLEVLKHKVKIGLGTDVAGGYSYSMLDAIRRAVMVSNVLLINKVNE
KNLTLKEVFRLATLGGSQALGLDSEIGNFEVGKEFDALLINPRASDSPIDLFYGDFVGDI
SEAVIQKFLYLGDDRNIEEVYVGGKQVVPFSSSV
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgtgtgcggctcggacgccgccgctggcgctcgtcttccgagggactttcgtccactcc
acctggacctgccccatggaggtgcttcgcgatcacctcctcggcgtgagcgacagcggc
aaaatagtgtttctagaagaatcatctcagcaagaaaaactggccaaggagtggtgcttc
aaaccatgtgagatcagagaactgagccaccatgagttcttcatgccaggccttgttgat
acccacatccatgcccctcagtatgcctttgctggaagcaacgttgacctgccgcttttg
gagtggctgaataagtatacatttcccacagaacaaaggttccggagcactgatgtggct
gaagaagtctacactagagttgttaggagaacactgaagaacggcaccaccacggcttgc
tactttggaacaattcacactgactcatccctgatccttgcggaaattacagataaattt
gggcagcgagcatttgtgggcaaagtatgcatggatttgaatgatactgttccagaatac
aaggagaccaccgaggagtcagtcaaggagacagagagatttgtgtcagaaatgctgcaa
aagaattatccaagggtgaaacccatagtgaccccacgctttaccctttcttgcacggag
actctgatgagtgaacttggcaacatcgccaagacccatgatctgtacatccagagccat
ataagtgaaaatcgtgaagaaattgaagccgtgaaaagcttataccctagttacaaaaac
tacacagatgtctatgataaaaacaatcttctgacaaacaagacagtaatggcacatggc
tgctacctttctgaagaagaacttaacatcttcagtgaacgaggagcatccattgcacat
tgtcccaactctaatctgtcgctgagcagtggcttactgaacgtgcttgaggtcctgaag
cataaagtgaagatagggctggggacagatgtggctggtggctactcctattccatgctt
gatgccatcagaagagcagtcatggtttccaatgtcctcttaattaataaggtaaatgag
aaaaacctcaccctcaaagaagtcttcagactagccactcttggaggaagccaagccctg
gggcttgatagcgagattggaaactttgaagttggcaaggaatttgatgccctcttgatc
aaccccagagcatcagactctcccattgatctgttttatggggattttgttggtgatatt
tctgaggctgttatccagaagtttctttatctaggagacgaccgaaatattgaggaggtt
tatgtgggtggaaagcaggtcgttccattctccagctcagtgtaa

DBGET integrated database retrieval system