KEGG   Mus musculus (mouse): 14555Help
Entry
14555             CDS       T01002                                 

Gene name
Gpd1, AI747587, GPD-C, GPDH-C, Gdc-1, Gdc1
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase 1 (soluble)
  KO
K00006  glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    14555 (Gpd1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.8  glycerol-3-phosphate dehydrogenase (NAD+)
     14555 (Gpd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_Gly3P_dh_N NAD_Gly3P_dh_C F420_oxidored
Motif
Other DBs
NCBI-GeneID: 14555
NCBI-ProteinID: NP_034401
MGI: 95679
Ensembl: ENSMUSG00000023019
Vega: OTTMUSG00000034997
UniProt: P13707
Position
15 F1; 15 56.13 cM
AA seq 349 aa AA seqDB search
MAGKKVCIVGSGNWGSAIAKIVGSNAGRLAHFDPRVTMWVFEEDIGGRKLTEIINTQHEN
VKYLPGHKLPPNVVAIPDVVQAATGADILVFVVPHQFIGKICDQLKGHLKANTIGISLIK
GVDEGPNGLKLISEVIGERLGIPMSVLMGANIASEVAEEKFCETTIGCKDPAQGQLLKDL
MQTPNFRITVVQEVDTVEICGALKNIVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAK
LFCSGTVSSATFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKEMLNGQKLQGP
QTARELHSILQHKGLVDKFPLFTAVYKVCYEGQPVGEFIRCLQNHPEHM
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggctggcaagaaagtctgcattgtcggctctggcaactggggctcagccattgccaag
atcgtgggtagcaatgcaggccggctggcacactttgacccacgggtgaccatgtgggtg
tttgaggaagacatcgggggcagaaagctaactgagatcatcaacactcagcacgagaat
gttaaatacctgccagggcacaagctgccccccaatgtggtggccatcccagacgtggtc
caggctgcaacaggcgctgacatcctggtttttgtggtaccccatcagttcattggcaag
atctgtgaccagctcaagggccacttgaaggccaatactattggcatatctcttattaag
ggggtagacgagggccccaacgggctgaagctcatttctgaagtgattggggagcgcctt
ggcattcccatgagcgtgctgatgggggccaacattgccagcgaggtggctgaggagaag
ttctgtgagacgaccatcggctgcaaggacccggcccagggacagctcctgaaggacctg
atgcagacacccaactttcgcatcactgtggtacaagaggtggacacagtggagatctgt
ggggccttgaagaatatagtggccgttggggctggcttctgtgatgggcttggcttcggt
gacaacaccaaggcggcggtgatccggttggggctcatggagatgatcgccttcgccaag
ctcttctgcagtggcactgtgtcctcggccaccttcctggagagctgcggggtcgcagac
ctcatcacgacctgctatggggggcggaaccgcaaggtggcagaggcctttgctcgaact
ggaaagtccattgagcagctggagaaggagatgctaaatgggcagaagctacaggggccc
cagacagcccgggagctgcacagcattctccaacacaagggccttgtggacaagttcccc
ttgttcactgcggtgtacaaagtgtgctatgagggccagccagtgggcgaattcatccgc
tgtctgcagaaccacccggaacacatgtga

DBGET integrated database retrieval system