KEGG   Mus musculus (mouse): 14563Help
Entry
14563             CDS       T01002                                 

Gene name
Gdf5, BMP-14, Cdmp-1, bp, brp
Definition
(RefSeq) growth differentiation factor 5
  KO
K04664  growth differentiation factor 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04350  TGF-beta signaling pathway
mmu04390  Hippo signaling pathway
Module
mmu_M00679  BMP signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    14563 (Gdf5)
   04390 Hippo signaling pathway
    14563 (Gdf5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    14563 (Gdf5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14563 (Gdf5)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   14563 (Gdf5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta TGFb_propeptide
Motif
Other DBs
NCBI-GeneID: 14563
NCBI-ProteinID: NP_032135
MGI: 95688
Ensembl: ENSMUSG00000038259
Vega: OTTMUSG00000015989
UniProt: P43027 Q8BRW9
Position
2 H1; 2 77.26 cM
AA seq 495 aa AA seqDB search
MRLPKLLTLLLWHLAWLDLELICTVLGAPDLGQRTPGAKPGLTKAEAKERPPLARNVFRP
GGHIYGVGATNARAKGSSGQTQAKKDEPRKMPPRSGGPETKPGPSSQTRQAAARTVTPKG
QLPGGKASSKAGSAPSSFLLKKTREPGTPREPKEPFRPPPITPHEYMLSLYRTLSDADRK
GGNSSVKLEAGLANTITSFIDKGQDDRGPAVRKQRYVFDISALEKDGLLGAELRILRKKP
LDVAKPAVPSSGRVAQLKLSSCPSGRQPAALLDVRSVPGLDGSGWEVFDIWKLFRNFKNS
AQLCLELEAWERGRAVDLRGLGFERTARQVHEKALFLVFGRTKKRDLFFNEIKARSGQDD
KTVYEYLFSQRRKRRAPLANRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEA
FHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVV
YKQYEDMVVESCGCR
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgagactccccaaactcctcactcttttgctgtggcacctggcttggctggacctggaa
ctcatctgcactgtgctgggtgcccctgacttaggacagagaaccccaggggccaagcca
gggttgaccaaagcggaggccaaggagaggccacccctggccaggaatgtctttaggcca
gggggtcatatctatggtgtgggggccaccaatgccagggccaagggaagctctgggcag
acacaggccaagaaggatgaacccagaaagatgccccccagatccggtggccctgaaacc
aagccaggaccctcttcccagactagacaggctgcagcccggactgtaaccccaaaagga
cagcttcctgggggcaaagcatcttcaaaagcaggatctgcccccagctccttcctgctg
aagaagaccagggagcctgggacccctcgagagcccaaggagccgttccgcccgcccccc
atcacaccccacgaatacatgctctccctgtacaggacgctgtccgatgctgacagaaag
ggaggtaacagcagcgtgaagttggaggctggcctggccaacaccatcaccagctttatt
gacaaagggcaagatgaccgaggccctgcggtcaggaagcagaggtacgtgtttgacatc
agtgccttggagaaggatgggctgttgggggctgaactgcggatcttacggaagaagccc
ttggacgtggccaagccagcggtccccagtagcgggcgggttgcccaactgaagctgtcc
agctgccccagcggccggcagccggcagccttgctggatgtgcgctccgtgccaggcctg
gatggatctggctgggaggtgttcgacatctggaagctcttccgaaattttaagaactca
gcgcagctgtgcctggagctggaggcctgggaacggggccgggccgtggacctccgtggc
ctgggctttgaacgcactgcccgacaggtccacgagaaagccttgttcctagtgtttggt
cgtaccaagaaacgggacctgttctttaatgagattaaggcccgctctggccaggatgac
aagactgtgtatgaatatttgttcagccagcggcggaaacgccgggccccattggccaat
cgccagggcaagcgacccagcaagaacctcaaggctcgctgcagtcgcaaggccttgcat
gtcaacttcaaggacatgggctgggacgactggatcatcgcacctcttgagtatgaggcc
ttccactgcgaaggactgtgtgagttccccttgcgctcccacttggagcccacaaaccac
gcagtcattcagaccctaatgaactctatggaccctgaatccacaccacccacttgttgt
gtgcctacacggctgagtcctattagcatcctcttcatcgactctgccaacaacgtggtg
tataaacagtacgaggacatggtcgtggaatcttgtggctgcaggtag

DBGET integrated database retrieval system