KEGG   Mus musculus (mouse): 14567
Entry
14567             CDS       T01002                                 

Gene name
Gdi1, GDIA, GDIalpha
Definition
(RefSeq) guanosine diphosphate (GDP) dissociation inhibitor 1
  KO
K17255  Rab GDP dissociation inhibitor
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14567 (Gdi1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   14567 (Gdi1)
SSDB
Motif
Pfam: GDI Amino_oxidase
Other DBs
NCBI-GeneID: 14567
NCBI-ProteinID: NP_034403
MGI: 99846
Ensembl: ENSMUSG00000015291
Vega: OTTMUSG00000017683
UniProt: P50396
Position
X A7.3; X 37.97 cM
AA seq 447 aa
MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQILE
GPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVP
STETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQNTSMRDVYRKFDLGQD
VIDFTGHALALYRTDDYLDQPCLETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFAR
LSAIYGGTYMLNKPVDDIIMENGKVVGVKSEGEVARCKQLICDPSYIPDRVQKAGQVIRI
ICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISYAHNVAAQGKYIAIASTTVETA
EPEKEVEPALELLEPIDQKFVAISDLYEPIDDGSESQVFCSCSYDATTHFETTCNDIKDI
YKRMAGSAFDFENMKRKQNDVFGEADQ
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggatgaggaatacgatgtgattgtgctggggacaggtcttaccgaatgcatcctgtct
ggcatcatgtctgtgaatggaaagaaggtgctgcacatggaccgaaacccctactatggg
ggtgagagctcttccatcacacccctggaggagctatataagcgctttcagatactggaa
gggccccctgaatcaatgggccggggccgagactggaatgttgacttgatccccaaattc
ctcatggccaatggtcagctggtaaagatgctactatatacagaagtgactcgatatctg
gacttcaaggtggtagagggcagctttgtatataaggggggcaagatctacaaagtgcca
tccaccgagactgaggccttggcttctaatctgatgggcatgtttgaaaaacgacgcttc
cgaaaatttttggtgtttgtggcaaactttgatgagaatgaccccaaaacctttgagggt
gttgatccccagaacaccagcatgcgtgatgtctaccggaagtttgacctgggtcaagat
gtcatagatttcactggccatgccttggcgctctaccgcactgatgactacctggatcag
ccctgtcttgagactattaaccgcatcaagttgtacagcgagtccctggcccggtatggc
aagagcccctatttatacccactgtatggcctgggtgagctgccccagggctttgccaga
ttgagtgccatctatgggggaacatacatgctgaacaaaccagtggatgacatcatcatg
gaaaatggcaaggtggtgggtgtcaaatctgagggagaggtggcccgctgcaagcagctg
atctgtgatcccagttacatcccagaccgtgtgcaaaaggctggccaggttattcgcatc
atctgtatcctcagccaccccatcaagaataccaatgatgccaattcctgccaaattatc
atccctcagaaccaggtcaacaggaagtcagacatctatgtgtgcatgatctcctatgcg
cacaacgtggccgcacagggcaaatacatcgccattgccagcaccactgtagagactgca
gaaccagaaaaggaagttgagcctgcattggagctgttggaacccattgaccagaagttt
gtggctatcagtgatttatatgagcccattgatgatggttcagagagtcaggtgttctgt
tcctgctcctatgatgctaccacacactttgagacaacctgcaatgacatcaaagatatc
tacaaacgcatggctggttctgcctttgattttgagaacatgaagcgcaaacagaatgat
gtctttggagaagctgatcagtga

DBGET integrated database retrieval system