KEGG   Mus musculus (mouse): 14569
Entry
14569             CDS       T01002                                 

Gene name
Gdi2, GDI-B, GDIB, Gdi3
Definition
(RefSeq) guanosine diphosphate (GDP) dissociation inhibitor 2
  KO
K17255  Rab GDP dissociation inhibitor
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14569 (Gdi2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   14569 (Gdi2)
SSDB
Motif
Pfam: GDI
Other DBs
NCBI-GeneID: 14569
NCBI-ProteinID: NP_032138
MGI: 99845
Ensembl: ENSMUSG00000021218
UniProt: Q61598 Q3UPA3
Position
13; 13 A1
AA seq 445 aa
MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDQNPYYGGESASITPLEDLYKRFKLPG
QPPASMGRGRDWNVDLIPKFLMANGQLVKMLLFTEVTRYMDFKVIEGSFVYKGGKIYKVP
STEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGVDPKKTSMRDVYKKFDLGQD
VIDFTGHSLALYRTDDYLDQPCCETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFAR
LSAIYGGTYMLNKPIEEIIVQNGKVVGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRV
ICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETK
EPEKEIRPALELLEPIEQKFVSISDLFVPKDLGTDSQIFISRAYDATTHFETTCDDIKDI
YKRMTGSEFDFEEMKRKKNDIYGED
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgaatgaggaatacgacgtgatcgtgctgggcaccggcctgacggaatgtatcctgtcg
gggataatgtcagtgaatgggaagaaggttcttcatatggatcagaacccatactatgga
ggagaaagtgcgtctataacaccgctggaagatttatacaaaaggtttaaattaccagga
caaccgccagcatcaatgggaagaggaagagactggaatgttgacttaattcccaagttc
cttatggccaatggtcagttggtgaagatgctgcttttcacagaggtcactcgttacatg
gacttcaaagtgattgagggaagctttgtctacaagggagggaaaatctacaaggttcct
tccactgaagcagaagccctggcatctagcttaatgggactgtttgagaaacgccgtttc
aggaagttcctggtttatgttgccaactttgatgaaaaagatcctagaactttcgagggt
gttgatcctaagaagacctccatgagagatgtgtataagaagtttgatttgggccaagat
gttatagactttactggccattctcttgcactgtacagaacagatgactacttagatcag
ccgtgttgtgaaaccattaatagaattaaactttacagcgagtctttggcaagatacggt
aaaagcccgtacctgtatccgctttatggtcttggagaattgccgcaaggatttgcaagg
ttaagtgccatatatggaggtacctacatgttgaataaaccaattgaagaaatcattgtg
caaaatggaaaagtggttggtgtaaaatccgaaggagagattgctcgctgtaaacagctc
atctgtgatcccagctatgtaaaagatcgggttgaaaaagtgggccaggtaatcagagtg
atctgtatccttagccaccctatcaagaacaccaacgatgccaactcctgccagatcatc
attccacagaaccaagtcaaccgcaagtcagatatctatgtttgcatgatctcctttgca
cataatgtggcagcacagggcaagtatattgccattgtaagtacaaccgtggagaccaag
gaaccagagaaagaaatcagaccggctttggagctcttggaaccaattgaacagaaattt
gtcagcatcagtgacctctttgtacctaaagatttgggaacagatagtcagatcttcatt
tcccgtgcctatgatgctaccacgcactttgagacaacctgtgatgacattaaagatatc
tacaagaggatgacaggatctgagtttgactttgaggaaatgaagcgcaagaagaatgac
atttatggagaagactaa

DBGET integrated database retrieval system