KEGG   Mus musculus (mouse): 14573
Entry
14573             CDS       T01002                                 

Gene name
Gdnf, AI385739, ATF
Definition
(RefSeq) glial cell line derived neurotrophic factor
  KO
K05452  glial cell derived neurotrophic factor
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14573 (Gdnf)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14573 (Gdnf)
SSDB
Motif
Pfam: TGF_beta
Other DBs
NCBI-GeneID: 14573
NCBI-ProteinID: NP_001288286
MGI: 107430
Ensembl: ENSMUSG00000022144
UniProt: P48540
Position
15; 15 A1
AA seq 211 aa
MKLWDVVAVCLVLLHTASAFPLPAGKRLLEAPAEDHSLGHRRVPFALTSDSNMPEDYPDQ
FDDVMDFIQATIKRLKRSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVL
TAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQACCR
PVAFDDDLSFLDDNLVYHILRKHSAKRCGCI
NT seq 636 nt   +upstreamnt  +downstreamnt
atgaagttatgggatgtcgtggctgtctgcctggtgttgctccacaccgcgtctgccttc
ccgctgcccgccggtaagaggcttctcgaagcgcccgctgaagaccactccctcggccac
cgccgcgtgcccttcgcgctgaccagtgactccaatatgcctgaagattatcctgaccag
tttgatgacgtcatggattttattcaagccaccattaaaagactgaaaaggtcaccagat
aaacaagcggcagcgcttcctcgaagagagaggaatcggcaggctgcagctgccagccca
gagaattccagagggaaaggtcgcagaggccagaggggcaaaaatcgggggtgcgtttta
actgccatacacttaaatgtcactgacttgggtttgggctatgaaaccaaggaggaactg
atctttcgatattgcagcggttcctgtgaatcggccgagacaatgtatgacaaaatacta
aaaaacctgtctcggagtagaaggctaacaagtgacaaagtaggccaggcatgttgcagg
ccggtcgccttcgacgacgacctgtcgtttttagatgacaacctggtttaccatattcta
agaaagcattccgctaaacggtgtggatgtatctga

DBGET integrated database retrieval system