KEGG   Mus musculus (mouse): 14581
Entry
14581             CDS       T01002                                 

Gene name
Gfi1, AW495828, Gfi-1, Pal-1, Pal1
Definition
(RefSeq) growth factor independent 1 transcription repressor
  KO
K09223  growth factor independent 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    14581 (Gfi1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    14581 (Gfi1)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 zf-met zf-BED zf-Di19 zf-CHCC zf-C2H2_3rep BolA zf_C2H2_ZHX
Other DBs
NCBI-GeneID: 14581
NCBI-ProteinID: NP_034408
MGI: 103170
Ensembl: ENSMUSG00000029275
Vega: OTTMUSG00000033123
UniProt: P70338 A0A0R4J292
Position
5 F; 5 52.23 cM
AA seq 423 aa
MPRSFLVKSKKAHSYHQPRSPGPDYSLRLETVPAPGRAEGGAVSAGESKMEPRERLSPDS
QLTEAPDRASASPNSCEGSVCDPCSEFEDFWRPPSPSVSPASEKSLCRSLDEAQPYTLPF
KPYAWSGLAGSDLRHLVQSYRQCSALERSAGLSLFCERGSEPGRPAARYGPEQAAGGAGA
GQPGSCGVAGGATSAAGLGLYGDFAPAAAGLYERPSTAAGRLYQDHGHELHADKSVGVKV
ESELLCTRLLLGGGSYKCIKCSKVFSTPHGLEVHVRRSHSGTRPFACEMCGKTFGHAVSL
EQHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHT
FIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQH
GLK
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgccgcgctcattcctggtcaagagcaagaaggcgcacagctatcaccagccgcgttct
ccggggccggactactccctgcgcctggagaccgtgcctgcgccgggcagagcagagggc
ggcgctgtgagtgcaggcgagtcgaaaatggagccccgagagcgtttgtcccccgactct
cagcttaccgaggctcccgacagggcctccgcgtcccccaacagctgcgaaggcagcgtt
tgtgacccctgctccgagttcgaggacttttggaggcccccttctccctccgtgtctcca
gcgtcggagaagtcactgtgccgctctctggacgaagcccagccctacacgctgcctttc
aagccctatgcatggagcggtcttgctgggtctgacctgcggcacctggtgcagagctat
cggcagtgcagcgcgctggagcgcagcgcgggcctgagcctcttctgcgagcgcggctcg
gagccgggccgcccggcagcgcgctacggccccgagcaggctgcgggcggagccggtgcg
ggacagccagggagctgcggggtcgccgggggcgccaccagcgctgcgggcctggggctc
tacggcgacttcgcgcctgcggcggccgggctgtacgagcggccgagcacagcagcaggc
cggctgtaccaagatcatggccacgagctgcacgcggacaagagcgtgggcgtcaaggtg
gagtcggagctgctttgcacccgtctgctgctgggcggcggctcctacaaatgcatcaaa
tgcagcaaggtgttctccacaccgcacgggctggaggtgcacgtgcgccggtcccacagc
ggcacaagaccctttgcgtgcgagatgtgcggcaagaccttcgggcacgcggtgagcctg
gagcaacacaaggcagtgcactcccaggaacgcagctttgactgtaagatctgtggcaag
agcttcaagaggtcatccacgctgtccacacatctgctcattcactcggacacccggccc
tatccctgtcagtactgtggcaaaagattccaccagaagtcagatatgaagaaacacacc
ttcatccacacaggtgagaagccccacaaatgccaggtgtgcggcaaagccttcagtcag
agctccaacctcatcactcatagcagaaagcacacaggcttcaagccctttggctgtgac
ctgtgtgggaagggcttccagaggaaggtggatctcaggaggcaccgagagactcagcat
ggactcaaatga

DBGET integrated database retrieval system