KEGG   Mus musculus (mouse): 14582Help
Entry
14582             CDS       T01002                                 

Gene name
Gfi1b, Gfi-1B
Definition
(RefSeq) growth factor independent 1B
  KO
K09223  growth factor independent 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    14582 (Gfi1b)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    14582 (Gfi1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 zf-met Ta0938 Zn-ribbon_8 zf_C2H2_ZHX zf-BED FYVE zinc_ribbon_15 zf-C2H2_8 HypA
Motif
Other DBs
NCBI-GeneID: 14582
NCBI-ProteinID: NP_032140
MGI: 1276578
Ensembl: ENSMUSG00000026815
Vega: OTTMUSG00000011746
UniProt: O70237
Position
2; 2 A3
AA seq 330 aa AA seqDB search
MPRSFLVKSKKAHTYHQPRAQGDELVWPPAVIPVAKEHSQSASPLLSTPLPSQTLDWNTI
KQEREMLLNQSLPKMASAPEGPLVTPQPQDGESPLSESPPFYKPSFSWDTLASSYSHSYT
QTPSTMQSAFLERSVRLYGSPLVPSTESPLDFRLRYSPGMDTYHCVKCNKVFSTPHGLEV
HVRRSHSGTRPFACDVCGKTFGHAVSLEQHTHVHSQERSFECRMCGKAFKRSSTLSTHLL
IHSDTRPYPCQFCGKRFHQKSDMKKHTYIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTG
FKPFSCELCTKGFQRKVDLRRHRESQHNLK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgccacggtcctttctagtgaagagtaagaaggcacacacttaccaccagccccgggca
cagggtgatgagctggtctggcctcctgctgtaattcctgtggcaaaagagcatagccag
agtgccagccctcttctcagcacaccgcttccaagccagaccttggactggaacacaatc
aaacaggagcgggagatgttgctgaaccagagccttcccaagatggcctcagccccagag
gggcctctcgtgacaccccaaccccaggatggggaatcaccactctctgagtcaccccct
ttctacaagcccagcttctcctgggataccttggcctcctcctacagccacagctacaca
cagaccccctccaccatgcagtccgccttcctggagcgctccgtgaggctgtacggcagc
cccctcgtgcccagcacagagtctcccttggacttccgcctccgctactctccaggcatg
gacacttaccactgtgtcaagtgcaacaaggtgttctccacccctcatgggctagaagtg
catgtccgccgctctcacagcggaacccggccctttgcctgtgatgtctgtggcaaaacc
tttggccacgctgtgagcttggagcagcatactcacgtccactcacaggagcgaagcttc
gagtgccggatgtgtggcaaagccttcaagcgttcatccaccctgtccacccacctgctc
atccactcggacactcggccctacccctgccagttctgtgggaagcgcttccaccagaag
tcggacatgaagaaacacacctacatccacacaggtgagaagccccacaagtgccaggtg
tgtgggaaagccttcagccagagctccaacctcatcacccacagccgcaagcacacaggc
ttcaagccgttcagctgtgagctgtgcaccaagggcttccagcgcaaggtggacctgcga
cgtcaccgtgagagtcaacacaatctcaagtga

DBGET integrated database retrieval system