KEGG   Mus musculus (mouse): 14584
Entry
14584             CDS       T01002                                 

Gene name
Gfpt2, AI480523, GFAT2
Definition
(RefSeq) glutamine fructose-6-phosphate transaminase 2
  KO
K00820  glutamine---fructose-6-phosphate transaminase (isomerizing) [EC:2.6.1.16]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00250  Alanine, aspartate and glutamate metabolism
mmu00520  Amino sugar and nucleotide sugar metabolism
mmu01100  Metabolic pathways
mmu04931  Insulin resistance
Module
mmu_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    14584 (Gfpt2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    14584 (Gfpt2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    14584 (Gfpt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    14584 (Gfpt2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     14584 (Gfpt2)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C44
   14584 (Gfpt2)
SSDB
Motif
Pfam: SIS GATase_6 GATase_7 GATase_4 GATase_2 SIS_2 Acetyltransf_6
Other DBs
NCBI-GeneID: 14584
NCBI-ProteinID: NP_038557
MGI: 1338883
Ensembl: ENSMUSG00000020363
Vega: OTTMUSG00000005570
UniProt: Q9Z2Z9 Q3V0X4
Position
11 B1.2; 11 29.9 cM
AA seq 682 aa
MCGIFAYMNYRVPKTRKEIFETLIRGLQRLEYRGYDSAGVAIDGNNHEVKERHIHLVKKR
GKVKALDEELYKQDSMDLKVEFETHFGIAHTRWATHGVPNAVNSHPQRSDKDNEFVVIHN
GIITNYKDLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLEG
AFALVFKSIHYPGEAVATRRGSPLLIGVRSKYKLSTEQIPVLYPTCNIENVKNICKTRMK
RLDSSTCLHAVGDKAVEFFFASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRVKRSAT
DDPSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVFNTMRGRVNFETNTVLLGGLKDH
LKEIRRCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFF
ISQSGETADTLLALRYCKDRGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYT
SQFISLVMFGLMMSEDRISLQNRRQEIIRGLRSLPELIKEVLSLDEKIHDLALELYTQRS
LLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKQMPVIMVIMKDPCF
AKCQNALQQVTARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH
LAVLRGYDVDFPRNLAKSVTVE
NT seq 2049 nt   +upstreamnt  +downstreamnt
atgtgcggaatctttgcctacatgaattacagagttcccaagacaaggaaagagattttc
gaaacccttatcaggggtctgcagcggctggagtaccggggctatgactctgcgggggtt
gccattgatgggaataaccacgaagtcaaagaaagacacatccatcttgtgaagaaaagg
gggaaagtaaaggctctggatgaagaactttacaagcaagatagcatggacttgaaggtg
gagtttgagacacacttcggcattgcccacacacgttgggccacccacggggttcccaat
gctgtcaacagtcacccgcagcgttcggacaaagacaatgaatttgttgtcatccacaac
gggatcatcactaattacaaggatctaaggaagtttctggaaagcaaaggctacgagttt
gagtcagaaacagacacggagaccatcgccaagctgattaaatatgtatttgacaacaga
gagactgaggacataacgttttccacattggtcgaaagagtcattcagcagttggaaggc
gcctttgcactggttttcaagagtattcactacccgggagaagctgtcgccacgaggaga
ggcagccccttgctcatcggggtacgaagcaaatacaaactctccacagagcagatcccc
gtcttatatccgacatgcaatatcgagaatgtgaagaatatctgcaagactaggatgaag
agactggacagctccacctgcctgcacgctgtgggcgataaagctgtggaattcttcttt
gcttctgatgcaagtgccatcatagaacacaccaaccgggtcatcttcttagaagatgat
gatatcgctgcagtggctgatgggaaactctccattcaccgagtcaagcgctcagctact
gatgacccctcccgagccatccagaccttgcagatggaactgcagcaaataatgaaaggt
aacttcagcgcatttatgcagaaggagatcttcgagcagccagaatcagtttttaatacc
atgagaggtcgggtgaattttgagaccaacacagtgctcctgggtggcttgaaggaccat
ttgaaagagatccgacgatgccgaaggctcattgtgattggctgtggaaccagctaccat
gccgctgtggctacacggcaagtcttagaggaactgaccgagctgcctgtgatggttgaa
cttgccagtgactttctggacaggaacacacctgtgttcagggatgacgtttgctttttc
ataagccaatcaggtgagactgcagacacgctcctggcgctgcgatactgtaaggatcga
ggtgcgctgaccgtgggcatcaccaacaccgtgggtagctccatctcccgggagactgac
tgtggcgtccacatcaacgcagggcccgagattggggtggccagcaccaaggcgtacacc
agccagttcatctctctggtgatgtttggtttgatgatgtctgaagatcgaatttctcta
cagaacaggagacaagagatcatccgtggcctcagatctttaccggagctgatcaaagaa
gtgctgtccctggatgagaagatccatgacttggccctggagctctacacacaaaggtct
ctcctcgtgatgggacggggatataactatgccacatgtctggaaggtgccttgaaaatt
aaggagataacctacatgcattcagaaggtatcctagccggagagctgaagcacgggccc
cttgctctcgtcgacaagcagatgccagtcatcatggtcatcatgaaggatccttgcttt
gccaagtgccagaatgccctgcagcaggtcactgcccgccagggtcgcccaatcatactg
tgttccaaggatgacaccgagagctccaagtttgcatataaaaccattgaacttccccac
acagtggactgtctccagggtatcctgagcgtgattccactccagcttctgtccttccac
ctggctgtcctccgaggttatgatgttgacttccccagaaacctagccaagtctgtcact
gtggaatga

DBGET integrated database retrieval system