KEGG   Mus musculus (mouse): 14585
Entry
14585             CDS       T01002                                 

Gene name
Gfra1, AU042498
Definition
(RefSeq) glial cell line derived neurotrophic factor family receptor alpha 1
  KO
K19895  GDNF family receptor alpha
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    14585 (Gfra1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Receptors
  14585 (Gfra1)
SSDB
Motif
Pfam: GDNF
Other DBs
NCBI-GeneID: 14585
NCBI-ProteinID: NP_034409
MGI: 1100842
Ensembl: ENSMUSG00000025089
Vega: OTTMUSG00000033056
UniProt: P97785
Position
19 D2; 19 54.18 cM
AA seq 468 aa
MFLATLYFVLPLLDLLMSAEVSGGDRLDCVKASDQCLKEQSCSTKYRTLRQCVAGKETNF
SLTSGLEAKDECRSAMEALKQKSLYNCRCKRGMKKEKNCLRIYWSMYQSLQGNDLLEDSP
YEPVNSRLSDIFRAVPFISDVFQQVEHISKGNNCLDAAKACNLDDTCKKYRSAYITPCTT
SMSNEVCNRRKCHKALRQFFDKVPAKHSYGMLFCSCRDVACTERRRQTIVPVCSYEERER
PNCLNLQDSCKTNYICRSRLADFFTNCQPESRSVSNCLKENYADCLLAYSGLIGTVMTPN
YIDSSSLSVAPWCDCSNSGNDLEDCLKFLNFFKDNTCLKNAIQAFGNGSDVTMWQPAPPV
QTTTATTTTAFRIKNKPLGPAGSENEIPTHVLPPCANLQAQKLKSNVSGSTHLCLSDNDY
GKDGLAGASSHITTKSMAAPPSCGLSSLPVMVFTALAALLSVSLAETS
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgttcctagccactctgtacttcgtgctgccactcctggatttgctgatgtcggccgag
gtgagtggtggggaccgcctggactgtgtgaaagccagtgatcagtgcctgaaggaacag
agctgcagcaccaagtaccgcacactgaggcagtgcgtggcgggcaaggaaaccaacttc
agcctgacatccggcctcgaggccaaggatgagtgccgcagcgctatggaggccttgaag
cagaagtctctctacaactgccgctgcaagcggggcatgaagaaagagaagaattgtctg
cgtatctactggagcatgtaccagagcctgcagggaaatgacctactggaagattcccca
tatgagccggttaacagcaggctgtcagatatattccgggcagtcccgttcatatcagat
gttttccagcaagtggaacacatttccaaagggaacaactgcctcgatgcagccaaggcc
tgcaacctggatgacacctgcaagaagtacaggtccgcctacatcaccccctgtaccacc
agcatgtccaatgaagtctgcaaccgccgcaagtgccacaaagccctcaggcagttcttc
gacaaagttccagccaagcacagctacgggatgctcttctgctcctgccgggacgtcgcc
tgcaccgagaggcggcgacagactatcgtccctgtgtgctcctatgaagaacgagagagg
cccaactgcctgaatctgcaagactcctgcaagacaaattacatctgcagatctcgcctt
gcagatttttttaccaactgccagccagagtcaaggtctgtcagcaactgtcttaaggag
aactacgcagactgcctcctggcctactcgggactgattggcacagtcatgactcctaac
tacatagactccagcagcctcagtgtggcgccgtggtgcgattgcagcaacagtggcaat
gacctggaagattgcctgaagtttctgaatttttttaaggacaatacgtgtctcaaaaat
gcaattcaagcctttggcaatggctcggatgtgaccatgtggcagccagcccccccagtc
cagaccaccactgccacgactaccactgccttccggatcaagaacaagcctctagggcca
gcaggctctgagaatgagattcccacacacgttttaccaccgtgtgctaatttgcaggca
cagaagctgaaatccaatgtatcgggcagtacacatctctgtctttctgataatgattac
ggaaaggatggtctcgctggtgcctccagccacataaccacaaaatcaatggctgctcct
cccagctgcggtctgagctcactgccggtgatggtgttcaccgctctggctgccctgttg
tctgtatcattggcagaaacatcgtag

DBGET integrated database retrieval system