KEGG   Mus musculus (house mouse): 14593
Entry
14593             CDS       T01002                                 
Symbol
Ggps1, 1810026C22Rik, 9530089B04Rik
Name
(RefSeq) geranylgeranyl diphosphate synthase 1
  KO
K00804  geranylgeranyl diphosphate synthase, type III [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00900  Terpenoid backbone biosynthesis
mmu01100  Metabolic pathways
Module
mmu_M00367  C10-C20 isoprenoid biosynthesis, non-plant eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    14593 (Ggps1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:mmu01006]
    14593 (Ggps1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     14593 (Ggps1)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     14593 (Ggps1)
    2.5.1.29  geranylgeranyl diphosphate synthase
     14593 (Ggps1)
Prenyltransferases [BR:mmu01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   14593 (Ggps1)
SSDB
Motif
Pfam: polyprenyl_synt
Other DBs
NCBI-GeneID: 14593
NCBI-ProteinID: NP_001318048
MGI: 1341724
Ensembl: ENSMUSG00000021302
UniProt: Q9WTN0 Q9CZZ6 Q3V0T8
Position
13:complement(14224375..14238319)
AA seq 300 aa
MEKTKEKAERILLEPYRYLLQLPGKQVRSKLSQAFNHWLKVPEDKLQIIIEVTEMLHNAS
LLIDDIEDSSKLRRGFPVAHSIYGVPSVINSANYVYFLGLEKVLTLDHPDAVKLFTRQLL
ELHQGQGLDIYWRDTYTCPTEEEYKAMVLQKTGGLFGLAVGLMQLFSDYKEDLKPLLDTL
GLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPESTQVQNILRQRTEN
IDIKKYCVQYLEDVGSFAYTRHTLRELEAKAYKQIEACGGNPSLVALVKHLSKMFTEENK
NT seq 903 nt   +upstreamnt  +downstreamnt
atggagaaaactaaagagaaagctgagaggattcttctagagccctataggtacttactt
cagttaccaggtaaacaggtgagaagcaaactttcacaggcatttaatcactggctgaaa
gttccagaagacaagctacagattatcattgaagtgactgaaatgttgcataatgccagt
ttactcattgatgatattgaagacagttcaaagctccgacgtggtttcccagtggctcac
agcatctatggtgtcccatctgtcattaattctgccaattacgtctacttccttggactg
gaaaaagtcttaacccttgatcacccggatgcggtgaagcttttcacacgccagcttctg
gaacttcatcagggacaaggcctcgatatttactggagggacacctacacttgtccaact
gaagaagaatataaagccatggtgttgcagaagacaggtggtttgtttggattagcagta
ggtcttatgcagctgttctctgattacaaagaagatctaaagccactgcttgacacactt
gggctctttttccagattagagatgattatgccaatctacactccaaagaatacagtgaa
aacaaaagtttctgtgaagacttgacagaagggaagttctcattccccactatccatgcc
atttggtcaaggccagaaagcacccaggtacagaacatcctgcgccagagaacagagaat
atagatattaaaaagtattgtgtgcagtacctggaggatgtaggttcttttgcatacact
cgacacactcttagagagcttgaagctaaagcctacaaacaaattgaggcctgtggtggg
aacccttcactagtggctttagtcaagcacttaagtaagatgttcacagaagaaaataaa
taa

DBGET integrated database retrieval system