KEGG   Mus musculus (mouse): 14600Help
Entry
14600             CDS       T01002                                 

Gene name
Ghr, GHBP, GHR/BP
Definition
(RefSeq) growth hormone receptor
  KO
K05080  growth hormone receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    14600 (Ghr)
   04151 PI3K-Akt signaling pathway
    14600 (Ghr)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14600 (Ghr)
   04060 Cytokine-cytokine receptor interaction
    14600 (Ghr)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  Prolactin receptor family
   14600 (Ghr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GHBP EpoR_lig-bind fn3 Cna_B
Motif
Other DBs
NCBI-GeneID: 14600
NCBI-ProteinID: NP_001273299
MGI: 95708
Ensembl: ENSMUSG00000055737
Vega: OTTMUSG00000030599
UniProt: P16882 Q3UP14
Position
15 A1; 15 1.84 cM
AA seq 650 aa AA seqDB search
MDLCQVFLTLALAVTSSTFSGSEATPATLGKASPVLQRINPSLGTSSSGKPRFTKCRSPE
LETFSCYWTEGDNPDLKTPGSIQLYYAKRESQRQAARIAHEWTQEWKECPDYVSAGKNSC
YFNSSYTSIWIPYCIKLTTNGDLLDQKCFTVDEIVQPDPPIGLNWTLLNISLTGIRGDIQ
VSWQPPPNADVLKGWIILEYEIQYKEVNESKWKVMGPIWLTYCPVYSLRMDKEHEVRVRS
RQRSFEKYSEFSEVLRVIFPQTNILEACEEDIQFPWFLIIIFGIFGVAVMLFVVIFSKQQ
RIKMLILPPVPVPKIKGIDPDLLKEGKLEEVNTILGIHDNYKPDFYNDDSWVEFIELDID
EADVDEKTEGSDTDRLLSNDHEKSAGILGAKDDDSGRTSCYDPDILDTDFHTSDMCDGTL
KFAQSQKLNMEADLLCLDQKNLKNLPYDASLGSLHPSITQTVEENKPQPLLSSETEATHQ
LASTPMSNPTSLANIDFYAQVSDITPAGGVVLSPGQKIKAGIAQGNTQREVATPCQENYS
MNSAYFCESDAKKCIAVAPRMEATSCIKPSFNQEDIYITTESLTTTAQMSETADIAPDAE
MSVPDYTTVHTVQSPRGLILNATALPLPDKKNFPSSCGYVSTDQLNKIMQ
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggatctttgtcaggtcttcttaaccttggcactggcagtcaccagcagcacattttct
ggaagtgaggctacaccagctactcttggcaaagcttccccagttctgcaaagaatcaat
ccaagcctggggacaagttcttctggaaagcctcgattcaccaagtgtcgttcccctgaa
ctggagacattttcatgctactggacagaaggagataatcctgatttaaagaccccagga
tctattcagctgtactatgctaaaagggaaagccaacgacaagctgcaagaattgctcat
gaatggacccaggaatggaaagaatgccctgattatgtctctgctggaaaaaacagctgt
tacttcaactcatcatatacctccatttggataccctactgcatcaagctaactacaaat
ggtgatttgctggaccaaaaatgtttcactgttgacgaaatagtgcaacctgatccaccc
attggcctcaactggactttactaaacattagtttgaccgggattcgtggagacatccaa
gtgagttggcaaccaccacccaatgcagatgttctgaagggatggataattctggagtat
gaaattcagtacaaagaagtaaatgaatcaaaatggaaagtgatgggccctatatggtta
acatactgtccagtgtactcattgagaatggataaagaacatgaagtgcgggtgagatcc
agacaacggagctttgaaaagtacagcgagttcagcgaagtcctccgtgtaatatttcct
cagacgaacatattggaagcatgtgaagaagatatccagtttccatggttcttaattatt
atctttggaatatttggagtagcagtgatgctatttgtagttatattttcaaagcagcaa
aggattaagatgctgattttacccccagtcccagttccaaagattaaagggattgatcca
gatcttctcaaggaagggaagttggaggaggtgaacaccatcttaggcattcatgataac
tacaaacccgacttctacaatgatgattcctgggtcgagttcattgagctagatattgat
gaagcagatgtggatgagaagactgaagggtctgacacagacagacttctaagcaatgat
catgagaaatcagctggtatccttggagcaaaggatgatgattctgggcgtaccagctgt
tacgaccctgacattttggatactgatttccataccagtgacatgtgtgatggtaccttg
aagtttgctcagtcacagaagttaaatatggaagctgatctcttgtgccttgatcagaag
aatctgaagaacttgccttatgatgcttcccttggctctctgcatccctccattacccag
acagtagaagaaaacaagccacagccacttttgagcagcgaaactgaggcaacccaccaa
ctcgcctctacaccgatgagtaatcccacatcactggcaaacattgacttttatgcccaa
gtaagcgacattacaccagcaggtggtgtagtcctttccccaggccaaaagattaaggca
gggatagcccaaggcaatacccagcgggaggtggccacgccctgccaagaaaattacagc
atgaacagtgcctacttttgtgagtcagatgccaaaaaatgcatcgctgtggcccctcgc
atggaagccacgtcttgtataaaaccaagctttaaccaagaggacatttacatcaccaca
gaaagccttaccactactgcccagatgtctgagacagcagatattgctccagatgctgag
atgtctgtcccagactacaccacggttcacaccgtgcagtctccaaggggccttatactc
aacgcaactgctttgcctttgcctgacaaaaagaattttccctcctcgtgtggttatgtg
agcacagaccaactgaacaaaatcatgcagtag

DBGET integrated database retrieval system