KEGG   Mus musculus (mouse): 14607
Entry
14607             CDS       T01002                                 

Gene name
Gip
Definition
(RefSeq) gastric inhibitory polypeptide
  KO
K05258  gastric inhibitory polypeptide
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    14607 (Gip)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14607 (Gip)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    14607 (Gip)
SSDB
Motif
Pfam: Hormone_2
Other DBs
NCBI-GeneID: 14607
NCBI-ProteinID: NP_032145
MGI: 107504
Ensembl: ENSMUSG00000014351
Vega: OTTMUSG00000001954
UniProt: P48756
Position
11; 11 D
AA seq 144 aa
MVALKTCSLLLVLLFLAVGLGEKEEVEFRSHAKFAGPRPRGPRYAEGTFISDYSIAMDKI
RQQDFVNWLLAQRGKKSDWKHNITQREARALVLAGQSQGKEDKEAQESSLPKSLSDDDVL
RDLLIQELLAWMVDQTELCRLRSQ
NT seq 435 nt   +upstreamnt  +downstreamnt
atggtggctttgaagacctgctctctgttgctggtgctcctgttcctggctgttgggctg
ggagaaaaagaagaggttgagttccgatcccatgctaaatttgctggccctcgacctcga
ggtccaaggtacgcagaggggactttcatcagtgattacagcatcgccatggacaagatc
cgacaacaagacttcgtgaactggctgctggcacagagggggaagaagagtgactggaaa
cacaacatcacccagagagaggcccgggctttggtgctggcagggcaatctcagggaaag
gaggacaaagaggcacaggagagctctttgcccaagagcctcagtgatgatgatgtgctg
agagaccttctgattcaagagctactggcctggatggtggaccaaacagagctctgccga
ctcaggtctcagtga

DBGET integrated database retrieval system