KEGG   Mus musculus (mouse): 14608
Entry
14608             CDS       T01002                                 

Symbol
Gpr83, AW045253, Gir, Gpr72, RP105, RP39, RP82
Name
(RefSeq) G protein-coupled receptor 83
  KO
K04210  G protein-coupled receptor 83
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14608 (Gpr83)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    14608 (Gpr83)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Neuropeptide Y
    14608 (Gpr83)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 DUF5439
Other DBs
NCBI-GeneID: 14608
NCBI-ProteinID: NP_034417
MGI: 95712
Ensembl: ENSMUSG00000031932
Vega: OTTMUSG00000027389
UniProt: P30731 Q542Q9 Q544C4
Position
9:14771038..14782085
AA seq 423 aa
MKVPPVLLLFLLSSVRATEQPQVVTEHPSMEAALTGPNASSHFWANYTFSDWQNFVGRRR
YGAESQNPTVKALLIVAYSFTIVFSLFGNVLVCHVIFKNQRMHSATSLFIVNLAVADIMI
TLLNTPFTLVRFVNSTWVFGKGMCHVSRFAQYCSLHVSALTLTAIAVDRHQVIMHPLKPR
ISITKGVIYIAVIWVMATFFSLPHAICQKLFTFKYSEDIVRSLCLPDFPEPADLFWKYLD
LATFILLYLLPLFIISVAYARVAKKLWLCNTIGDVTTEQYLALRRKKKTTVKMLVLVVVL
FALCWFPLNCYVLLLSSKAIHTNNALYFAFHWFAMSSTCYNPFIYCWLNENFRVELKALL
SMCQRPPKPQEDRLPSPVPSFRVAWTEKSHGRRAPLPNHHLPSSQIQSGKTDLSSVEPVV
AMS
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgaaggttcctcctgtcctgcttctctttcttctgtcctcagtgcgagctactgagcaa
ccgcaggtcgtcactgagcatcccagcatggaggcagccctgaccgggcccaacgcctcc
tcgcacttctgggccaactacactttctctgactggcagaacttcgtgggcaggagacgt
tatggggccgagtcccagaaccccacggtgaaagcactgctcatcgtggcctactcattc
accatcgtcttctcgctcttcggtaatgtcctggtctgtcatgtcatcttcaagaaccag
cgcatgcactcggccaccagcctcttcattgtcaacctggcagtggcggacatcatgatc
acattgctcaacacgcccttcactttggtccgctttgtgaacagcacatgggtgtttggg
aagggcatgtgtcatgtcagtcgctttgctcagtactgttctctacatgtctcagcactg
actctgacagctatcgcagtggaccgccaccaggtcatcatgcatccactgaagcctcgg
atctccatcaccaagggtgtcatatatattgctgtcatctgggtcatggctaccttcttc
tctctgccacatgccatctgccagaaactgtttaccttcaagtacagtgaggacattgtg
cgctccctctgcctgccggacttcccggagccagctgacctcttctggaagtatctggac
ctggccaccttcatcctgctctacctacttccactcttcattatctcagtggcctatgct
cgtgtggccaagaagctgtggctctgtaacaccattggcgacgtgaccacagagcagtac
ctcgccctgcgacgcaagaagaagaccaccgtgaagatgctggtgcttgtggtagtcctc
tttgccctctgctggttccctctcaactgctatgtcctcctcttgtccagcaaggccatc
cacaccaacaatgccctctactttgccttccactggtttgccatgagcagtacttgttat
aaccccttcatctactgctggctcaatgagaactttagggttgagcttaaggcattgctg
agcatgtgccaaaggccacccaagccgcaggaagacaggctaccctccccagttccttcc
ttcagggtggcatggacagagaagagccatggtcggagggctccactacctaatcaccac
ttgccctcttcccagatccagtctgggaagacagatctgtcatctgtggaacccgttgtg
gccatgagttag

DBGET integrated database retrieval system