KEGG   Mus musculus (mouse): 14609
Entry
14609             CDS       T01002                                 

Symbol
Gja1, AU042049, AW546267, Cnx4, Cnx43, Cx43, Cx43al, Cx43alpha1, Cxnk1, Gja-, Gja-1, Npm1, conne, connexin43
Name
(RefSeq) gap junction protein, alpha 1
  KO
K07372  gap junction alpha-1 protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04540  Gap junction
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    14609 (Gja1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    14609 (Gja1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14609 (Gja1)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   14609 (Gja1)
SSDB
Motif
Pfam: Connexin Connexin43 Connexin40_C Ammonium_transp
Other DBs
NCBI-GeneID: 14609
NCBI-ProteinID: NP_034418
MGI: 95713
Ensembl: ENSMUSG00000050953
UniProt: P23242 Q8C4N2 A0A654ICD2
Position
10 B4; 10 28.64 cM
AA seq 382 aa
MGDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPG
CENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDG
VNVEMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSVFEVAFLLIQWYIYGFS
LSAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRV
KGRSDPYHATTGPLSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRN
YNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDSQNAKKVAAGHELQPLAIVD
QRPSSRASSRASSRPRPDDLEI
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgggtgactggagcgccttggggaagctgctggacaaggtccaagcctactccacggcc
ggagggaaggtgtggctgtcggtgctcttcattttcagaatcctgctcctggggacagcg
gttgagtcagcttggggtgatgaacagtctgcctttcgctgtaacactcaacaacccggt
tgtgaaaatgtctgctatgacaagtccttccccatctctcacgtgcgcttctgggtcctt
cagatcatattcgtgtctgtgcccacactcctgtacttggctcacgtgttctatgtgatg
agaaaggaagagaagctgaacaagaaagaagaggagctcaaagtggcgcagaccgacggg
gtcaacgtggagatgcacctgaagcagattgaaatcaagaagttcaagtatgggattgaa
gaacacggcaaggtgaagatgagaggtggcctgctgagaacctacatcatcagcatcctc
ttcaagtctgtcttcgaggtggccttcctgctgatccagtggtacatctatgggttcagc
ctgagtgcggtctacacctgcaagagagatccctgcccccaccaggtggactgcttcctc
tcacgtcccacggagaaaaccatcttcatcatcttcatgctggtggtgtccttggtgtct
ctcgctctgaatatcattgagctcttctatgtcttcttcaagggcgttaaggatcgcgtg
aagggaagaagcgatccttaccacgccaccaccggcccactgagcccatccaaagactgc
ggatctccaaaatatgcttacttcaatggctgctcctcaccaacggccccactctcacct
atgtctcctcctgggtacaagctggtcactggtgacagaaacaattcctcctgccgcaat
tacaacaagcaagccagcgagcaaaactgggcgaattacagcgcagagcaaaatcgaatg
gggcaggccggaagcaccatctccaactcccacgcccagccgtttgatttccctgacgac
agccaaaatgccaaaaaagttgctgctggacacgaactccagcccttagctatcgtggat
cagcgaccttccagcagagccagcagccgcgccagcagcagacctcggcctgatgacctg
gagatttaa

DBGET integrated database retrieval system