KEGG   Mus musculus (mouse): 14611
Entry
14611             CDS       T01002                                 

Gene name
Gja3, Cnx46, Cx43, Cx46, Cxnj1, Gja-3
Definition
(RefSeq) gap junction protein, alpha 3
  KO
K07612  gap junction alpha-3 protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14611 (Gja3)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   14611 (Gja3)
SSDB
Motif
Pfam: Connexin
Other DBs
NCBI-GeneID: 14611
NCBI-ProteinID: NP_001258552
MGI: 95714
Ensembl: ENSMUSG00000048582
UniProt: Q64448 A0A654ICY8 Q3UWF8
Position
14 C3; 14 29.82 cM
AA seq 417 aa
MGDWSFLGRLLENAQEHSTVIGKVWLTVLFIFRILVLGAAAEEVWGDEQSDFTCNTQQPG
CENVCYDRAFPISHIRFWALQIIFVSTPTLIYLGHVLHIVRMEEKKKEREEELLRRDNPQ
HGRGREPMRTGSPRDPPLRDDRGKVRIAGALLRTYVFNIIFKTLFEVGFIAGQYFLYGFQ
LQPLYRCDRWPCPNTVDCFISRPTEKTIFVIFMLAVACASLVLNMLEIYHLGWKKLKQGV
TNHFNPDASEARHKPLDPLPTATSSGPPSVSIGFPPYYTHPACPTVQAKAIGFPGAPLSP
ADFTVVTLNDAQGRNHPVKHCNGHHLTTEQNWTRQVAEQQTPASKPSSAASSPDGRKGLI
DSSGSSLQESALVVTPEEGEQALATTVEMHSPPLVLLDPGRSSKSSNGRARPGDLAI
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgggcgactggagcttcctggggcggctgctggagaacgcacaggagcactctacagtc
atcggcaaagtgtggctgaccgtgctgttcatcttccgcattctggtgttaggggcggca
gccgaggaggtgtggggcgacgagcaatcggacttcacctgcaacacacagcagccaggc
tgtgagaacgtctgctacgaccgcgctttccccatttcgcacatccgcttctgggcgctg
caaatcatcttcgtgtctacgcccaccctcatctatctgggccacgtgctacacatcgtg
cgcatggaggagaagaagaaagagcgggaggaagagctgctgaggagagacaaccctcag
cacggccgtggtcgcgagccaatgcgtacagggagcccgcgggaccctccactacgcgat
gaccgtggcaaggtgcgcatcgcaggtgcgctgctgcggacctacgtcttcaacatcatc
ttcaagacactcttcgaagtggggttcatcgcgggccagtactttctatacggcttccag
ctgcagccactttaccgctgcgaccgctggccctgccccaacactgtggactgtttcatc
tccaggcccacagagaagaccatctttgtcatcttcatgctggctgtggcctgtgcgtca
ctggtactcaacatgctggagatttaccacctgggctggaagaagctcaagcagggagtt
actaaccacttcaacccagatgcctcagaagccaggcacaagcccttggaccccctaccc
acggccaccagctctggcccgcccagcgtctccatcgggttcccaccttattacacacac
cctgcctgtcccacagtacaggcaaaggccatagggtttcctggggccccactatcacca
gcagacttcacagtggtgactctaaacgatgctcaaggcagaaaccacccagtcaaacac
tgcaatggccaccacctgacgacagagcagaactggaccaggcaagtggcagagcagcag
actccagccagcaagccctcttcagcagcatccagccctgatggccgcaaggggctcatt
gacagcagtggcagcagcttacaggagagtgccttggtagtgacgccagaggagggggaa
caggctttggccaccacagtggagatgcactcgccaccgttggtcctcctggacccagga
aggtccagcaagtccagcaacggacgtgccagaccaggtgacttggccatctag

DBGET integrated database retrieval system