KEGG   Mus musculus (mouse): 14615
Entry
14615             CDS       T01002                                 

Symbol
Gjc1, C130009G16Rik, Cnx45, Cx45, Cxnq, Gja, Gja-, Gja-7, Gja7
Name
(RefSeq) gap junction protein, gamma 1
  KO
K07616  gap junction gamma-1 protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14615 (Gjc1)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   14615 (Gjc1)
SSDB
Motif
Pfam: Connexin TLP-20 Connexin40_C
Other DBs
NCBI-GeneID: 14615
NCBI-ProteinID: NP_001152854
MGI: 95718
Ensembl: ENSMUSG00000034520
Vega: OTTMUSG00000002993
UniProt: P28229 A0A654IER4
Position
11; 11 E1
AA seq 396 aa
MSWSFLTRLLEEIHNHSTFVGKIWLTVLIVFRIVLTAVGGESIYYDEQSKFVCNTEQPGC
ENVCYDAFAPLSHVRFWVFQIILVATPSVMYLGYAIHKIAKMEHGEADKKAARSKPYAMR
WKQHRALEETEEDHEEDPMMYPEMELESEKENKEQSQPKPKHDGRRRIREDGLMKIYVLQ
LLARTVFEVGFLIGQYFLYGFQVHPFYVCSRLPCPHKIDCFISRPTEKTIFLLIMYGVTG
LCLLLNIWEMLHLGFGTIRDSLNSKRRELDDPGAYNYPFTWNTPSAPPGYNIAVKPDQIQ
YTELSNAKIAYKQNKANIAQEQQYGSHEEHLPADLETLQREIRMAQERLDLAIQAYHHQN
NPHGPREKKAKVGSKSGSNKSSISSKSGDGKTSVWI
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgagttggagcttcctgactcgcctgctagaggagatccacaaccattcgacatttgta
gggaagatctggctcactgtgctgattgtctttcgaattgtcctaactgctgtaggagga
gagtccatctactatgatgaacaaagcaaatttgtgtgcaacacagagcagccgggctgt
gagaatgtctgctatgatgcctttgccccgctctcccacgtgcgcttctgggtattccag
atcatcctggttgcaactccctctgtgatgtacctgggatatgctattcataagattgcc
aaaatggagcatggcgaggcagacaagaaggcagctcggagcaaaccctatgccatgcgt
tggaaacagcaccgggctctggaagaaacggaagaggaccatgaagaggatcctatgatg
tatccagagatggagttagaaagcgaaaaagaaaataaagagcagagccaaccaaaacct
aagcatgatggccgacgacgaattcgagaggatgggctcatgaaaatctatgtgttgcag
ctgctggccaggactgtgtttgaggtgggctttctaatagggcagtatttcctgtatggc
ttccaagtccacccattttatgtgtgcagcagacttccttgccctcataagatagactgc
tttatttctagacccactgaaaagaccatcttccttctgataatgtatggtgtcacaggc
ctctgcctattgcttaacatttgggagatgcttcacttagggtttgggacaattcgagac
tcactaaacagtaaaaggagggaacttgatgatccgggtgcttataattatcctttcact
tggaacacaccctctgctccccctggctataacattgctgtcaaaccagatcagatccag
tacactgagctgtccaatgctaagattgcctacaagcaaaacaaagccaatattgcccag
gaacagcagtacggcagccacgaggaacacctcccggctgatctggagactctgcagcgg
gagatcagaatggctcaggaacgcttggacctagcaatccaggcctaccatcaccaaaac
aacccccatggtcctcgggaaaagaaggccaaagtggggtccaaatctgggtccaacaaa
agcagtattagtagcaaatcaggggatgggaagacctccgtctggatttaa

DBGET integrated database retrieval system