KEGG   Mus musculus (mouse): 14617Help
Entry
14617             CDS       T01002                                 

Gene name
Gjd2, Gja9, connexin36, cx36
Definition
(RefSeq) gap junction protein, delta 2
  KO
K07373  gap junction delta-2 protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04540  Gap junction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    14617 (Gjd2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14617 (Gjd2)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   14617 (Gjd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Connexin
Motif
Other DBs
NCBI-GeneID: 14617
NCBI-ProteinID: NP_034420
MGI: 1334209
Ensembl: ENSMUSG00000068615
Vega: OTTMUSG00000015176
UniProt: O54851
Position
2; 2 E4
AA seq 321 aa AA seqDB search
MGEWTILERLLEAAVQQHSTMIGRILLTVVVIFRILIVAIVGETVYDDEQTMFVCNTLQP
GCNQACYDRAFPISHIRYWVFQIIMVCTPSLCFITYSVHQSAKQRERRYSTVFLALDRDP
AESIGGPGGTGGGGSGGSKREDKKLQNAIVNGVLQNTETTSKETEPDCLEVKELTPHPSG
LRTAARSKLRRQEGISRFYIIQVVFRNALEIGFLVGQYFLYGFSVPGLYECNRYPCIKEV
ECYVSRPTEKTVFLVFMFAVSGICVVLNLAELNHLGWRKIKLAVRGAQAKRKSVYEIRNK
DLPRVSVPNFGRTQSSDSAYV
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgggggaatggaccatcttggagaggctgctggaagccgcggtgcagcagcactccact
atgattgggaggatcctgttgactgtggtggtgatcttccggatactcattgtggccatt
gtaggggagacggtgtacgatgatgagcagaccatgtttgtgtgcaacaccctacagccc
ggctgtaaccaggcctgctatgaccgcgcctttcccatctcccatatacgttactgggtc
ttccagatcataatggtgtgcacccccagtctctgttttatcacctattctgtgcaccaa
tccgccaagcagcgagaacgccggtactctactgtcttcctagccctggacagagaccct
gctgagtctatagggggacctggaggaactgggggtgggggcagcggagggagcaaacga
gaagataagaagttgcaaaatgccattgtcaatggggtgctgcagaacacagagaccacc
agtaaggagacagaaccagattgcttagaggttaaagagctgactccacatccatctggg
ctgcgcacagcagcaaggtccaagctccgaagacaggaaggtatctcccgcttctacatc
atccaagtggtgtttcgaaatgctctggagattgggtttctggtgggccagtactttcta
tatggcttcagtgttccagggttgtatgagtgcaaccgttacccctgcatcaaggaggta
gaatgttatgtgtctagacctaccgagaagacagtctttctggtgttcatgtttgctgtg
agcggcatttgtgtggtgctcaatctggctgaacttaaccatctgggatggcggaagatc
aaactggctgtccggggagcccaggccaagaggaagtcagtctatgagatacgtaacaaa
gatctgcctcgagtcagtgttcccaatttcggcaggactcagtccagtgactctgcctat
gtgtga

DBGET integrated database retrieval system