KEGG   Mus musculus (mouse): 14619
Entry
14619             CDS       T01002                                 

Symbol
Gjb2, AI325222, Cnx26, Cx26, Cxne, Gjb-2
Name
(RefSeq) gap junction protein, beta 2
  KO
K07621  gap junction beta-2 protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14619 (Gjb2)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   14619 (Gjb2)
SSDB
Motif
Pfam: Connexin
Other DBs
NCBI-GeneID: 14619
NCBI-ProteinID: NP_032151
MGI: 95720
Ensembl: ENSMUSG00000046352
Vega: OTTMUSG00000034674
UniProt: Q00977 Q3UJE9
Position
14 C3; 14 30.1 cM
AA seq 226 aa
MDWGTLQSILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADFVCNTLQPGC
KNVCYDHHFPISHIRLWALQLIMVSTPALLVAMHVAYRRHEKKRKFMKGEIKNEFKDIEE
IKTQKVRIEGSLWWTYTTSIFFRVIFEAVFMYVFYIMYNGFFMQRLVKCNAWPCPNTVDC
FISRPTEKTVFTVFMISVSGICILLNITELCYLFVRYCSGKSKRPV
NT seq 681 nt   +upstreamnt  +downstreamnt
atggattggggcacactccagagcatcctcgggggtgtcaacaaacactccaccagcatt
ggaaagatctggctcacggtcctcttcatcttccgcatcatgatcctcgtggtggctgca
aaggaggtgtggggagatgagcaagccgattttgtctgcaacacgctccagcctggctgc
aagaatgtatgctacgaccaccacttccccatctctcacatccggctctgggctctgcag
ctgatcatggtgtccacgccagccctcctggtagctatgcatgtggcctaccggagacat
gaaaagaaacggaagttcatgaagggagagataaagaacgagtttaaggacatcgaagag
atcaaaacccagaaggtccgtatcgaagggtccctgtggtggacctacaccaccagcatc
ttcttccgggtcatctttgaagccgtcttcatgtacgtcttttacatcatgtacaatggc
ttcttcatgcaacgtctggtgaaatgcaacgcttggccctgccccaatacagtggactgc
ttcatttccaggcccacagaaaagactgtcttcaccgtgtttatgatttctgtgtctgga
atttgcattctgctaaatatcacagagctgtgctatttgttcgttaggtattgctcagga
aagtccaaaagaccagtctaa

DBGET integrated database retrieval system