KEGG   Mus musculus (mouse): 14625
Entry
14625             CDS       T01002                                 

Symbol
Gykl1, AI449806, Gk-rs1
Name
(RefSeq) glycerol kinase-like 1
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00561  Glycerolipid metabolism
mmu01100  Metabolic pathways
mmu03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    14625 (Gykl1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    14625 (Gykl1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14625 (Gykl1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     14625 (Gykl1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   14625 (Gykl1)
SSDB
Motif
Pfam: FGGY_N FGGY_C
Other DBs
NCBI-GeneID: 14625
NCBI-ProteinID: NP_034423
MGI: 891990
Ensembl: ENSMUSG00000053624
UniProt: Q8C635
Position
18:52826751..52828665
AA seq 549 aa
MAEAPKAVLGPLVGAVDQGTSSTRFLVFNPQTAELLCHHQVEIAQEFPKEGWVEQDPKAI
LQSVYECIEKACEKLGQQSIDISNIKAIGVTNQRETTIVWDKFTGEPLYNAVVWLDLRTQ
STVENLSKSISVSNNFVKNKTGLPISTYFSAVKLHWLIENVRKVQKAIEDGRAIFGTVDS
WLIWCMTGGINGGVHCTDVSNASRTMLFNIHSLQWDEELCDFFGIPMTILPRIRSSSEIY
GLVKSGVLEGVPISGCLGDQSAALVGQLCLQDGQAKSTYGTGCFLLCNTGQKCVNSEHGL
LTTVAYQLGRQEPVYYALEGSVAIAGAVVSWIKNNLQIIQSSSEIEKLAEVAGTSYGCYF
VPAFSGLYAPYWDPSARGIICGLTQFTNKFHIAFAALEAVCFQTREILDAMNSDCGIPLT
HLQVDGGMTANRVLMQLQADILCIPVMKPFMPETTALGVAMAAGAAEGVSVWSLDPKDLS
SVQMEKFEPQINVEESEGRYATWKKAVLKSMGWVLTQSPDGRDPSIFSSLTLGFYVVSSM
VILIGARYM
NT seq 1650 nt   +upstreamnt  +downstreamnt
atggcagaggctccaaaagcggttttggggccgttggtaggggcagtggaccaaggtacc
agctcaacacgttttttggttttcaatccccaaacagctgaattactttgtcatcatcaa
gtggaaatagcccaggagttcccaaaagaaggatgggtagagcaagacccaaaggcaatc
ctgcagtctgtgtacgagtgtatagagaaagcatgtgagaaactcggacagcagagcatt
gatatttccaacataaaagctatcggtgtcaccaaccagcgggaaactacgatagtctgg
gacaagttcactggagaacctctctacaatgctgtggtgtggcttgacctaaggacccag
tctactgtggagaatctcagcaaaagtatttcagtaagcaataactttgtcaagaacaag
acaggccttccaatcagcacttattttagtgccgtgaaacttcactggctcattgaaaat
gtgagaaaagtgcaaaaggctattgaagatggcagagctatttttgggacggttgattcg
tggcttatctggtgtatgactggaggtatcaacggaggtgtccactgtacagatgtaagt
aatgccagcaggaccatgcttttcaacattcactctttgcaatgggatgaagagctctgc
gacttttttggaattccaatgaccatccttccccgaatccggagttcttctgagatctat
ggcctagtgaaaagtggcgtgttggaaggtgtgccaatatctggatgtctgggagaccag
tctgctgctttggtgggacaactgtgtcttcaggacggacaagctaaaagcacatatgga
acaggctgtttcttactatgtaacacaggccagaagtgtgtaaactctgaacatggcctt
ctgaccacagtggcttaccagcttggcagacaggagcctgtctattatgccctggaaggt
tccgtagccatagccggtgctgttgttagctggataaaaaacaatcttcaaattattcag
tcttcatcggaaattgaaaaacttgctgaagtagcagggacttcttatggttgttacttc
gtcccagccttttcaggcttatacgctccatattgggacccaagtgcgagagggatcatc
tgcgggctcacccagttcaccaataagttccatattgcctttgctgcgttagaagctgtt
tgcttccaaacgcgggagattttggatgccatgaacagtgattgtggaatcccgctgacg
catttgcaggtagatggaggaatgaccgcaaacagagttctcatgcaactgcaggcggac
attctgtgtattccggtgatgaaacctttcatgccagaaacaactgcactgggagtcgca
atggcagcgggagcggcagaaggagttagcgtgtggagtctggatcctaaggatttgtca
agtgtccagatggagaagtttgaaccccagatcaatgtcgaggaaagtgaaggtcgttac
gccacatggaagaaagctgtgctgaagtcaatgggttgggttttgactcagtctcctgat
ggtcgcgaccctagtattttcagcagcctgacgctgggcttttatgtagtgagtagtatg
gtgatattaattggagcaaggtacatgtaa

DBGET integrated database retrieval system