KEGG   Mus musculus (house mouse): 14628
Entry
14628             CDS       T01002                                 
Symbol
Ostm1, 1200002H13Rik, HSPC019, gl
Name
(RefSeq) osteopetrosis associated transmembrane protein 1
  KO
K23863  osteopetrosis-associated transmembrane protein 1 (chloride channel 7 beta subunit)
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    14628 (Ostm1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    14628 (Ostm1)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Others
   Others
    14628 (Ostm1)
Ion channels [BR:mmu04040]
 Chloride channels
  Chloride channel (CLC)
   14628 (Ostm1)
SSDB
Motif
Pfam: OSTMP1 Crust_neurohorm zf-AD CECR6_TMEM121
Other DBs
NCBI-GeneID: 14628
NCBI-ProteinID: NP_766004
MGI: 2655574
Ensembl: ENSMUSG00000038280
UniProt: Q8BGT0
Position
10:42554912..42578458
AA seq 338 aa
MARDAELARSSGWPWRWLPALLLLQLLRWRCALCALPFTSSRHPGFADLLSEQQLLEVQD
LTLSLLQGGGLGPLSLLPPDLPDLEPECRELLMDFANSSAELTACMVRSARPVRLCQTCY
PLFQQVAIKMDNISRNIGNTSEGPRCGGSLLTADRMQIVLMVSEFFNSTWQEANCANCLT
NNGEDLSNNTEDFLSLFNKTLACFEHNLQGHTYSLLPPKNYSEVCRNCKEAYKNLSLLYS
QMQKLNGLENKAEPETHLCIDVEDAMNITRKLWSRTFNCSVTCSDTVSVVAVSVFILFLP
VVFYLSSFLHSEQKKRKLILPKRLKSSTSFANIQENAT
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggctcgggacgcggagctggcgcgcagtagcgggtggccgtggcggtggctgccggcg
ctgctgctgctgcagctgctgcggtggaggtgcgccctgtgcgcgctccccttcaccagc
agtcggcacccaggctttgcggacctgctgtcggagcagcagctgttggaggtgcaggac
ttgaccctgtctttgctgcagggcggaggtctagggccgctgtcactgctacctccggac
ctgccggatctggagcctgagtgccgggagctgctgatggacttcgccaatagcagcgcc
gagctgaccgcctgtatggtgcgcagcgctcggcccgtgcgcctctgccagacctgctac
ccgctcttccaacaggtcgcaatcaagatggacaacatcagccgaaacatcgggaatacc
tccgagggcccgcgctgtggcggaagtctcctgacggcagacagaatgcagatagttctc
atggtctctgagtttttcaacagcacgtggcaggaggcgaactgcgcaaattgcctaaca
aacaatggtgaggatttgtcaaacaacacagaggacttcctcagtctgtttaacaagact
ttggcctgctttgagcataacctgcaggggcacacatacagtctcctcccaccaaaaaat
tactccgaagtgtgcagaaactgtaaagaggcatataaaaacctgagcctcctgtacagt
caaatgcagaaactgaacgggcttgagaacaaggctgagcctgagacgcacttgtgcatc
gatgtggaggatgcaatgaacattactcggaagctttggagtcgaaccttcaactgttcg
gtcacctgcagcgacacggtgtccgtggttgctgtgtctgtgttcattctcttcctgcct
gtcgtcttctacctcagtagcttccttcactcagagcaaaagaaacgcaaactcattcta
cccaaacgtctcaagtcgagcaccagttttgccaacattcaagaaaatgccacctga

DBGET integrated database retrieval system