KEGG   Mus musculus (mouse): 14630Help
Entry
14630             CDS       T01002                                 

Gene name
Gclm, AI649393, Gcmc, Glclr
Definition
(RefSeq) glutamate-cysteine ligase, modifier subunit
  KO
K11205  glutamate--cysteine ligase regulatory subunit
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00270  Cysteine and methionine metabolism
mmu00480  Glutathione metabolism
mmu01100  Metabolic pathways
mmu04216  Ferroptosis
Module
mmu_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    14630 (Gclm)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14630 (Gclm)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    14630 (Gclm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 14630
NCBI-ProteinID: NP_032155
MGI: 104995
Ensembl: ENSMUSG00000028124
Vega: OTTMUSG00000021205
UniProt: O09172 Q4FJZ6
Position
3 G1; 3 52.94 cM
AA seq 274 aa AA seqDB search
MGTDSRAAGALLARASTLHLQTGNLLNWGRLRKKCPSTHSEELRDCIQKTLNEWSSQISP
DLVREFPDVLECTMSHAVEKINPDEREEMKVSAKLFIVGSNSSSSTRSAVDMACSVLGVA
QLDSVIMASPPIEDGVNLSLEHLQPYWEELENLVQSKKIVAIGTSDLDKTQLEQLYQWAQ
VKPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQESIPDIEAQ
DWVPLWLLRYSVIVKSRGIIKSKGYILQAKRRGS
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccgacagccgcgcggccggggcgctcctggcgcgggccagcaccctgcacctg
cagaccgggaacctgctcaactggggccgcctgcgaaaaaagtgcccgtccacgcacagc
gaggagcttcgggactgtatccaaaagaccttgaatgaatggagttcccaaatcagcccc
gatttagtcagggagtttccagatgttttggaatgcaccatgtcccatgcagtggagaag
ataaatcccgatgaaagagaagaaatgaaagtttctgcaaaactgttcattgtaggatcg
aattcttcatcatcaactagaagtgcagttgacatggcatgctccgtccttggagttgca
cagctggactctgtgatcatggcttcgcctccgattgaagatggagttaatctttccttg
gagcatttacagccttactgggaggaattagagaacttagttcagagcaagaaaattgtt
gctataggcacctctgatctagacaagacacagttggagcagctgtatcagtgggcacag
gtaaaacccaatagtaaccaagttaacctggcctcctgctgtgtgatgccaccagatttg
actgcctttgctaaacaatttgacatacagctactgactcacaatgacccgaaagaactg
ctctctgaggcaagtttccaggaagctcttcaagaaagcatccctgacattgaagcccag
gattgggtgccgctgtggctgctgaggtactcggtcatcgtgaagagcaggggaatcatc
aagtctaaaggctacattctgcaagccaaaaggaggggctcttaa

DBGET integrated database retrieval system