KEGG   Mus musculus (mouse): 14657
Entry
14657             CDS       T01002                                 

Gene name
Glra4
Definition
(RefSeq) glycine receptor, alpha 4 subunit
  KO
K05271  glycine receptor alpha-4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    14657 (Glra4)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  Glycine
   14657 (Glra4)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 14657
NCBI-ProteinID: NP_034427
MGI: 95750
Ensembl: ENSMUSG00000018595
Vega: OTTMUSG00000018721
UniProt: Q61603 Q2TB05
Position
X F1; X 59.1 cM
AA seq 456 aa
MTTLVPASLFLLLWTLPGKVLLSVALAKEDVKSGLKGSQPMSPSDFLDKLMGRTSGYDAR
IRPNFKGPPVNVTCNIFINSFGSVTETTMDYRVNVFLRQQWNDPRLAYREYPDDSLDLDP
SMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLILSCPMDLKNFPM
DIQTCTMQLESFGYTMNDLMFEWLEDAPAVQVAEGLTLPQFILRDEKDLGYCTKHYNTGK
FTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQ
SSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFMRLRRRQRRQRM
EEDIIRESRFYFRGYGLGHCLQARDGGPMEGSSIYSPQPPTPLLKEGETMRKLYVDRAKR
IDTISRAVFPFTFLVFNIFYWVVYKVLRSEDIHQAL
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgacaactcttgttccagcaagcctcttccttcttctctggaccttgccagggaaggtc
ctgctcagtgtggctttggcaaaagaggatgtcaaatctggactcaaaggatcccagcct
atgtccccctctgatttcttggacaagcttatgggacgaacatctggatatgatgctagg
attaggcccaatttcaaaggtccacctgtgaatgtgacctgcaacatcttcatcaacagt
tttggctccgtcactgagaccaccatggactaccgggtaaatgtcttcttgcggcagcag
tggaatgacccacgtctggcctaccgagaatatccagatgactctctcgacctagaccca
tccatgctcgactctatctggaaaccagacctcttctttgccaatgagaaaggggccaac
ttccatgaggtgaccacagacaacaagttactgcgcatcttcaagaatggaaatgttctc
tacagcatcagattgaccctcattttgtcctgcccaatggacctcaagaacttcccaatg
gacatacagacctgtacaatgcagctggaaagctttggctacaccatgaatgacctcatg
tttgagtggctagaagatgctcctgctgtccaagtggctgaggggttgactctaccccaa
tttattttgcgggatgagaaggatctagggtattgtaccaagcactacaatacaggaaaa
ttcacttgcattgaggtaaagtttcacctggagcggcagatgggctactatctgattcaa
atgtacatccccagcctactcatcgtcatcctgtcctgggtctccttctggatcaacatg
gatgcggcccctgctcgtgtaggccttggcatcaccacagtcctcaccatgacaactcag
agctctggatccagggcctctttgcctaaggtgtcctacgtaaaggcaattgacatctgg
atggctgtatgcctgctctttgtatttgctgccttgcttgagtatgctgcagtcaatttt
gtctctcgtcagcataaggaatttatgagacttcgtagaaggcagagacgtcagcgtatg
gaagaagacatcataagagagagccgcttctattttcgtggctatggcctaggacactgc
ttacaagcaagggatggaggtccaatggaaggttccagcatttatagtccccaacctcca
acccctcttctaaaggaaggagaaaccatgaggaaactctatgtggaccgagccaagaga
attgacaccatctccagggctgtcttcccttttacttttcttgtcttcaatatcttctat
tgggttgtctataaagtactaaggtcagaagatatccaccaggcactgtga

DBGET integrated database retrieval system