KEGG   Mus musculus (mouse): 14661
Entry
14661             CDS       T01002                                 

Gene name
Glud1, AI118167, Gdh-X, Glud, Gludl
Definition
(RefSeq) glutamate dehydrogenase 1
  KO
K00261  glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00220  Arginine biosynthesis
mmu00250  Alanine, aspartate and glutamate metabolism
mmu00471  D-Glutamine and D-glutamate metabolism
mmu00910  Nitrogen metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu04217  Necroptosis
mmu04964  Proximal tubule bicarbonate reclamation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    14661 (Glud1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    14661 (Glud1)
   00220 Arginine biosynthesis
    14661 (Glud1)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    14661 (Glud1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    14661 (Glud1)
 09150 Organismal Systems
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    14661 (Glud1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14661 (Glud1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     14661 (Glud1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   14661 (Glud1)
SSDB
Motif
Pfam: ELFV_dehydrog_N ELFV_dehydrog 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 14661
NCBI-ProteinID: NP_032159
MGI: 95753
Ensembl: ENSMUSG00000021794
Vega: OTTMUSG00000030736
UniProt: P26443 Q3TSQ7
Position
14 B; 14 20.8 cM
AA seq 558 aa
MYRRLGEALLLSRAGPAALGSAAADSAALLGWARGQPSAAPQPGLTPVARRHYSEAAADR
EDDPNFFKMVEGFFDRGASIVEDKLVEDLKTRESEEQKRNRVRGILRIIKPCNHVLSLSF
PIRRDDGSWEVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFG
GAKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGEREMSWIADTY
ASTIGHYDINAHACVTGKPISQGGIHGRISATGRGVFHGIENFINEASYMSILGMTPGFG
DKTFVVQGFGNVGLHSMRYLHRFGAKCVGVGESDGSIWNPDGIDPKELEDFKLQHGSILG
FPKAKVYEGSILEADCDILIPAASEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLER
NIMVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLMSVQESLERKFGK
HGGTIPVVPTAEFQDRISGASEKDIVHSGLAYTMERSARQIMRTAMKYNLGLDLRTAAYV
NAIEKVFKVYNEAGVTFT
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgtaccgccgtctgggcgaagcgctgctgctgtcccgcgccgggcccgctgccctgggc
tctgcggctgcagactcagccgcgctgctgggctgggcccgcggacagccctccgccgcc
ccgcaacccgggctcacgccggtcgcccggcgccactacagcgaagcggccgccgaccgc
gaagacgaccccaacttcttcaagatggtggagggcttcttcgaccgcggcgccagcatc
gtagaggacaagctggtggaagacctgaagacccgggagagcgaggagcagaagcggaac
cgggtgcgcggcatcctgaggatcatcaagccctgcaaccatgtgttgagcctctccttc
cccatccggcgcgacgacggctcctgggaggtcatcgaaggctaccgggcccagcacagc
cagcaccgcacgccctgcaagggaggtatccgttacagcactgacgtgagtgtggatgaa
gtaaaagcactggcttccttaatgacatacaagtgcgctgtggtcgatgtaccgtttgga
ggtgctaaagcaggcgttaagatcaaccccaagaactatacagataatgaattagaaaaa
attacacggaggttcactatggagctggccaagaagggttttattggtcctggcattgat
gtgcctgccccagacatgagcacgggtgagcgggagatgtcctggatcgctgacacctat
gccagcaccatagggcactatgatatcaatgcgcatgcctgtgttactgggaaacccatc
agtcaaggaggcatccacgggcgcatctccgctactggccggggtgtcttccatggaatt
gaaaacttcatcaatgaggcttcttacatgagcattttaggaatgacaccaggctttggc
gataagacatttgttgttcagggatttggtaatgtgggcctgcactctatgagatattta
catcgttttggtgctaaatgtgttggtgttggagagtctgatgggagtatatggaatccg
gatgggattgacccaaaagaactggaagacttcaagttgcaacatggatcaattctgggc
ttccccaaagccaaggtctatgaaggaagcatcttggaggctgactgtgacattctgatt
cctgccgccagcgagaagcagttgaccaaatccaatgcacccagagtcaaagccaagatc
attgctgaaggtgccaatgggccaaccactccagaggctgataagattttcctggaaaga
aacatcatggttattcccgatctctacttaaatgctggaggagtaacagtgtcttacttt
gagtggctaaagaatctaaatcatgtcagctacggccgattgaccttcaaatatgaaagg
gactctaactaccacttgctcatgtctgttcaagagagtttagagagaaagtttggaaag
catggtggaactattcctgtggtccccacagcagagttccaggacaggatatcgggtgca
tctgagaaagacattgtgcactctggcttggcctacacaatggagagatctgccaggcaa
attatgcgcacagccatgaagtataacctgggattggacctgagaacagctgcctatgtc
aatgctatcgagaaagtcttcaaggtgtacaatgaagctggtgtgaccttcacatag

DBGET integrated database retrieval system