KEGG   Mus musculus (mouse): 14670Help
Entry
14670             CDS       T01002                                 

Gene name
Gnl1, Gna-rs1, Gnal1
Definition
(RefSeq) guanine nucleotide binding protein-like 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: MMR_HSR1 FeoB_N RsgA_GTPase Inhibitor_I53 Dynamin_N HbrB
Motif
Other DBs
NCBI-GeneID: 14670
NCBI-ProteinID: NP_032162
MGI: 95764
Ensembl: ENSMUSG00000024429
Vega: OTTMUSG00000037220
UniProt: P36916 Q52KE3
Position
17 B1; 17 18.82 cM
AA seq 607 aa AA seqDB search
MPRKKPFSVKQKKKQLQDKRERKRGLQDGLRSSSNSRSGSRERREEQTDTSDGESVTHHI
RRLNQQPSQGLGPRGYDPNRYRLHFERDSREEVERRKRAAREQVLQPVSAEVLELDIREV
YQPGSVLDFPRRPPWSYEMSKEQLMSQEERSFQEYLGKIHGAYTSEKLSYFEHNLETWRQ
LWRVLEMSDIVLLITDIRHPVVNFPPALYEYVTGELGLALVLVLNKVDLAPPALVVAWKH
YFHQCYPQLHIVLFTSFPRDTRTPQEPGGVLKKNRRRGKGWTRALGPEQLLRACEAITVG
KVDLSSWREKIARDVAGASWGNVSGEEEEEEDGPAVLVEQLTDSAMEPTGPSRERYKDGV
VTIGCIGFPNVGKSSLINGLVGRKVVSVSRTPGHTRYFQTYFLTPSVKLCDCPGLIFPSL
LPRQLQVLAGIYPIAQIQEPYTSVGYLASRIPVQALLHLRHPEAEDPSAEHPWCAWDICE
AWAEKRGYKTAKAARNDVYRAANSLLRLAVDGRLSLCFYPPGYSEQRGTWESHPETAELV
LSQGRVGPAGDEEEEEEEELSSSCEEEGEEDRDADEEGEGDEDTPTSDPGSCLTARNPYA
LLGEDEC
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgccgaggaagaagcccttcagcgtgaagcagaagaagaagcagctgcaggacaagcgg
gagcggaagcgagggctccaagatgggctgcgctccagttccaacagccgcagcggtagc
cgggagcggcgggaggagcagacggacacgtcggatggggaatccgtgacccatcatatc
cgcaggctcaaccagcaaccttcccagggcctggggcccagaggctacgaccccaaccga
taccggctgcattttgaacgggacagccgggaggaggtggagaggagaaagagagcggcc
agagagcaagtgttgcagccggtcagtgctgaagtgttagagttggatatccgggaagtg
tatcagcctggctcagtcctggactttccccggcggcctccttggagttatgagatgtcc
aaggaacagctaatgagccaggaggagcggagcttccaggaataccttgggaagatacac
ggggcatacacttcagagaaactcagctactttgagcacaatctggagacatggaggcag
ctgtggcgggtgttagagatgtctgacatcgtcctgctcattactgacatccgacatccg
gttgtgaacttcccaccagcactttacgagtatgtaactggagagcttgggctggccctg
gtgctggtcttgaacaaggtggacctggccccgccggctctcgtggttgcctggaagcat
tattttcaccagtgctacccccagctccacattgtcttgttcacctctttccctcgggac
acgcgcactccacaggagcctggtggtgtcttgaagaagaatcggagacgggggaaagga
tggactcgggcactgggaccagagcagttgctgagagcctgtgaagctatcactgtgggg
aaagtggacttgagcagctggcgcgagaagattgctagggacgtggctggagcctcctgg
ggtaacgtctccggtgaggaagaggaggaggaagacgggccagcagtactggtagagcag
ctgaccgactcagccatggagcccacaggcccctccagggagcgctacaaggatggggtg
gtgactattggctgtataggtttccccaatgtggggaagtcctctctgatcaacgggctg
gtggggcggaaggtggtgagtgtctccagaacgccaggccacacccggtattttcagacc
tactttctgaccccctctgtgaagctctgtgactgcccgggccttatcttcccctcgctg
ctgcccaggcagctgcaggttctggctggaatctaccccattgcccagatccaggagccc
tacacttctgtgggctacctggcctccagaatccccgtgcaggccctgctgcacctgcgc
cacccagaggcagaggacccttcggctgagcacccctggtgtgcctgggacatctgtgaa
gcttgggcagagaaacgtggttataaaacggccaaggcagctcgaaatgacgtgtacaga
gcggccaatagcctacttcgcctggcagtggatggccgcctcagcctatgtttctaccct
cctggttacagcgaacagagaggcacctgggagtctcacccagagactgcagagctggtg
ctgtcgcagggcagggtggggccggcaggtgatgaggaggaggaagaggaggaggaactg
agcagctcctgtgaggaggaaggagaggaggaccgggatgcagatgaagagggagaagga
gatgaggacaccccaacttcagatcctgggtcctgcctaacagcccgaaacccgtatgcc
ctgctcggggaggatgagtgctga

DBGET integrated database retrieval system