KEGG   Mus musculus (mouse): 14673
Entry
14673             CDS       T01002                                 

Symbol
Gna12, AI414047, AI504261, Galp, Galpha12
Name
(RefSeq) guanine nucleotide binding protein, alpha 12
  KO
K04346  guanine nucleotide-binding protein subunit alpha-12
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04270  Vascular smooth muscle contraction
mmu04730  Long-term depression
mmu04810  Regulation of actin cytoskeleton
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu05163  Human cytomegalovirus infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14673 (Gna12)
   04072 Phospholipase D signaling pathway
    14673 (Gna12)
   04071 Sphingolipid signaling pathway
    14673 (Gna12)
   04022 cGMP-PKG signaling pathway
    14673 (Gna12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14673 (Gna12)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    14673 (Gna12)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    14673 (Gna12)
  09156 Nervous system
   04730 Long-term depression
    14673 (Gna12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14673 (Gna12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    14673 (Gna12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14673 (Gna12)
   04031 GTP-binding proteins [BR:mmu04031]
    14673 (Gna12)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   14673 (Gna12)
GTP-binding proteins [BR:mmu04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    14673 (Gna12)
SSDB
Motif
Pfam: G-alpha Arf GTP_EFTU FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 14673
NCBI-ProteinID: NP_034432
MGI: 95767
Ensembl: ENSMUSG00000000149
Vega: OTTMUSG00000024795
UniProt: P27600
Structure
PDB: 
1ZCA

Position
5 G2; 5 79.3 cM
AA seq 379 aa
MSGVVRTLSRCLLPAEAGARERRAGAARDAEREARRRSRDIDALLARERRAVRRLVKILL
LGAGESGKSTFLKQMRIIHGREFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIPWQHS
ENEKHGMFLMAFENKAGLPVEPATFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYF
LDNLDRIGQLNYFPSKQDILLARKATKGIVEHDFVIKKIPFKMVDVGGQRSQRQKWFQCF
DGITSILFMVSSSEYDQVLMEDRRTNRLVESMNIFETIVNNKLFFNVSIILFLNKMDLLV
EKVKSVSIKKHFPDFKGDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHFTTAIDTENIRFV
FHAVKDTILQENLKDIMLQ
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgtccggggtggtgcggacccttagccgctgcttgctgccggccgaggccggagcccgc
gagcgcagggcgggcgcggcgcgcgacgcggagcgcgaggcccgacggcgcagccgcgac
atcgacgcgctgctggcccgcgagcggcgcgcggtgcggcggctggtcaagatcctgctg
ctgggcgccggcgagagcggcaagtccaccttcctcaagcagatgcgcatcatccacggc
cgggagttcgaccagaaggcgctgctggagttccgcgacaccatcttcgacaacatcctt
aagggttcgagggttcttgtggacgctcgagacaagctcggcattccctggcagcactct
gagaacgagaagcacgggatgtttctgatggccttcgagaacaaggcagggctgcctgtg
gagcctgccaccttccagctctacgtgccagccctgagtgccctctggagagactcgggg
atcagggaagccttcagccgcagaagcgagttccagctgggtgaatcagtgaagtacttc
ctggataacttggaccggattggccagctgaactacttccccagtaagcaagacatcctg
ctggctagaaaggccaccaagggaatcgtggaacatgacttcgttataaagaaaatccca
tttaagatggtggatgtgggcggccagaggtcacagcgccagaagtggttccagtgcttc
gacggcatcacatctatcctgttcatggtgtcctcgagcgagtatgaccaggtcctcatg
gaggacaggcgcaccaaccggctggtggagtccatgaacatcttcgagaccatcgtcaac
aacaagctcttcttcaacgtctccatcatcctcttcctcaacaagatggacctcctggtg
gagaaggtgaagtctgtgagcattaagaagcacttcccagatttcaagggcgacccgcac
cggctggaggacgtccagcgctacctggtgcagtgcttcgacaggaagcgcaggaaccgc
agcaagcccctgttccaccacttcaccaccgccatagacaccgagaacatccgcttcgtg
tttcatgctgtgaaggacacgatcctgcaggagaacctgaaagacatcatgctgcagtga

DBGET integrated database retrieval system