KEGG   Mus musculus (house mouse): 14675
Entry
14675             CDS       T01002                                 
Symbol
Gna14, Hg1i
Name
(RefSeq) guanine nucleotide binding protein, alpha 14
  KO
K04636  guanine nucleotide-binding protein subunit alpha-14
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu05142  Chagas disease
mmu05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    14675 (Gna14)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    14675 (Gna14)
   05142 Chagas disease
    14675 (Gna14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    14675 (Gna14)
GTP-binding proteins [BR:mmu04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    14675 (Gna14)
SSDB
Motif
Pfam: G-alpha Arf Atx10homo_assoc Gtr1_RagA AAA_24 AAA_29
Other DBs
NCBI-GeneID: 14675
NCBI-ProteinID: NP_032163
MGI: 95769
Ensembl: ENSMUSG00000024697
UniProt: P30677 Q8CBT5 Q8C3M7
Position
19:16413031..16590706
AA seq 355 aa
MAGCCCLSAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHG
SGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYMCEQNKENAQIIREVEVDKVTAL
SRDQVAAIKQLWLDPGIQECYDRRREYQLSDSAKYYLTDIERIAMPSFVPTQQDVLRVRV
PTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDN
ENRMEESKALFRTIITYPWFLNSSVILFLNKKDLLEEKIMYSHLISYFPEYTGPKQDVKA
ARDFILKLYQDQNPDKEKVIYSHFTCATDTENIRFVFAAVKDTILQLNLREFNLV
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggccggctgctgctgtttgtctgcggaggagaaagagtctcagcgcatcagcgcggag
atcgagcggcagcttcgccgcgacaagaaggacgcgcgccgggagctcaagctgctgttg
ctgggaaccggtgagagtgggaaaagcacctttatcaagcagatgaggataatccatggg
tctggctacagtgatgaagatagaaagggcttcacgaagctggtttaccaaaacatattc
acggccatgcaagccatgatcagagcaatggataccctgaggatacaatacatgtgtgag
cagaataaggaaaatgcccagatcatcagggaagtggaagtagacaaggtcactgcactc
tctagagaccaggtggcagccatcaagcagctgtggctggatcccggaatccaggagtgt
tacgacaggaggagggagtaccagctgtcagactctgccaaatattacctgacggacatt
gagcgtatcgccatgccctctttcgtgccaacacaacaggatgtgcttcgtgttagagtg
cccaccactggcatcatagaatatccattcgacctggaaaacatcatcttccgaatggtg
gatgttggtggccagcgatctgaacgacggaaatggattcactgctttgagagtgtcacc
tccatcattttcttggttgctctgagtgaatatgaccaggttctggctgagtgtgacaat
gagaaccgcatggaggagagcaaagccctgtttagaaccatcatcacctacccctggttt
ctgaactcctccgtgattctgttcttaaacaagaaggatcttctagaggagaaaatcatg
tactctcatctaattagctacttcccagagtacacaggaccaaagcaagatgtcaaagcg
gccagggactttatcctgaagctgtatcaagaccagaatcctgacaaagagaaggttatc
tattctcacttcacttgtgctacagacaccgagaatatccgctttgtgtttgctgctgtc
aaagacacaatcctacagctaaacctacgggagttcaacttggtgtaa

DBGET integrated database retrieval system