KEGG   Mus musculus (mouse): 14683Help
Entry
14683             CDS       T01002                                 

Gene name
Gnas, 5530400H20Rik, A930027G11Rik, C130027O20Rik, GPSA, GSP, Galphas, Gnas1, Gnasxl, Gs-alpha, Gsa, Nesp, Nesp55, Nespl, Oed-Sml, Oedsml, P1, P2, P3, PHP1A, PHP1B, POH, SCG6
Definition
(RefSeq) GNAS (guanine nucleotide binding protein, alpha stimulating) complex locus
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04024  cAMP signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04540  Gap junction
mmu04611  Platelet activation
mmu04713  Circadian entrainment
mmu04714  Thermogenesis
mmu04724  Glutamatergic synapse
mmu04726  Serotonergic synapse
mmu04728  Dopaminergic synapse
mmu04730  Long-term depression
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04913  Ovarian steroidogenesis
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04918  Thyroid hormone synthesis
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04924  Renin secretion
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04934  Cushing syndrome
mmu04935  Growth hormone synthesis, secretion and action
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu04962  Vasopressin-regulated water reabsorption
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu04976  Bile secretion
mmu05030  Cocaine addiction
mmu05031  Amphetamine addiction
mmu05032  Morphine addiction
mmu05034  Alcoholism
mmu05142  Chagas disease (American trypanosomiasis)
mmu05146  Amoebiasis
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    14683 (Gnas)
   04020 Calcium signaling pathway
    14683 (Gnas)
   04072 Phospholipase D signaling pathway
    14683 (Gnas)
   04024 cAMP signaling pathway
    14683 (Gnas)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    14683 (Gnas)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    14683 (Gnas)
  09152 Endocrine system
   04911 Insulin secretion
    14683 (Gnas)
   04922 Glucagon signaling pathway
    14683 (Gnas)
   04923 Regulation of lipolysis in adipocytes
    14683 (Gnas)
   04912 GnRH signaling pathway
    14683 (Gnas)
   04913 Ovarian steroidogenesis
    14683 (Gnas)
   04915 Estrogen signaling pathway
    14683 (Gnas)
   04921 Oxytocin signaling pathway
    14683 (Gnas)
   04926 Relaxin signaling pathway
    14683 (Gnas)
   04935 Growth hormone synthesis, secretion and action
    14683 (Gnas)
   04918 Thyroid hormone synthesis
    14683 (Gnas)
   04928 Parathyroid hormone synthesis, secretion and action
    14683 (Gnas)
   04916 Melanogenesis
    14683 (Gnas)
   04924 Renin secretion
    14683 (Gnas)
   04925 Aldosterone synthesis and secretion
    14683 (Gnas)
   04927 Cortisol synthesis and secretion
    14683 (Gnas)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    14683 (Gnas)
   04270 Vascular smooth muscle contraction
    14683 (Gnas)
  09154 Digestive system
   04970 Salivary secretion
    14683 (Gnas)
   04971 Gastric acid secretion
    14683 (Gnas)
   04972 Pancreatic secretion
    14683 (Gnas)
   04976 Bile secretion
    14683 (Gnas)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    14683 (Gnas)
   04961 Endocrine and other factor-regulated calcium reabsorption
    14683 (Gnas)
  09156 Nervous system
   04724 Glutamatergic synapse
    14683 (Gnas)
   04728 Dopaminergic synapse
    14683 (Gnas)
   04726 Serotonergic synapse
    14683 (Gnas)
   04730 Long-term depression
    14683 (Gnas)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    14683 (Gnas)
  09159 Environmental adaptation
   04713 Circadian entrainment
    14683 (Gnas)
   04714 Thermogenesis
    14683 (Gnas)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14683 (Gnas)
  09165 Substance dependence
   05030 Cocaine addiction
    14683 (Gnas)
   05031 Amphetamine addiction
    14683 (Gnas)
   05032 Morphine addiction
    14683 (Gnas)
   05034 Alcoholism
    14683 (Gnas)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    14683 (Gnas)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    14683 (Gnas)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    14683 (Gnas)
   05165 Human papillomavirus infection
    14683 (Gnas)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    14683 (Gnas)
   05142 Chagas disease (American trypanosomiasis)
    14683 (Gnas)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    14683 (Gnas)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14683 (Gnas)
   04031 GTP-binding proteins [BR:mmu04031]
    14683 (Gnas)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   14683 (Gnas)
  Exosomal proteins of other body fluids (saliva and urine)
   14683 (Gnas)
  Exosomal proteins of colorectal cancer cells
   14683 (Gnas)
  Exosomal proteins of bladder cancer cells
   14683 (Gnas)
GTP-binding proteins [BR:mmu04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    14683 (Gnas)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc GTP_EFTU AAA_29 TniB
Motif
Other DBs
NCBI-GeneID: 14683
NCBI-ProteinID: NP_001297012
MGI: 95777
Ensembl: ENSMUSG00000027523
Vega: OTTMUSG00000016388
UniProt: P63094
Position
2 H4; 2 97.89 cM
AA seq 394 aa AA seqDB search
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQM
RILHVNGFNGEGGEEDPQAARSNSDGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELA
NPENQFRVDYILSVMNVPNFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLD
KIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFND
VTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEK
VLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCY
PHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcctcggcaacagtaagaccgaggaccagcgcaacgaggagaaggcgcagcgc
gaggccaacaaaaagatcgagaagcagctgcagaaggacaagcaggtctaccgggccacg
caccgcctgctgctgctgggtgctggagagtctggcaaaagcaccattgtgaagcagatg
aggatcctgcatgttaatgggtttaacggagagggcggcgaagaggacccgcaggctgca
aggagcaacagcgatggtgagaaggccactaaagtgcaggacatcaaaaacaacctgaag
gaggccattgaaaccattgtggccgccatgagcaacctggtgccccctgtggagctggcc
aaccctgagaaccagttcagagtggactacattctgagcgtgatgaacgtgccgaacttt
gacttcccacctgaattctatgagcatgccaaggctctgtgggaggatgagggagtgcgt
gcctgctacgagcgctccaatgagtaccagctgattgactgtgcccagtacttcctggac
aagattgatgtgatcaagcaggccgactacgtgccaagtgaccaggacctgcttcgctgc
cgtgtcctgacctctggaatctttgagaccaagttccaggtggacaaagtcaacttccac
atgttcgatgtgggcggccagcgcgatgagcgccgcaagtggatccagtgcttcaatgat
gtgactgccatcatcttcgtggtggccagcagcagctacaacatggtcattcgggaggac
aaccagactaaccgcctgcaggaggctctgaacctcttcaagagcatctggaacaacaga
tggctgcgcaccatctctgtgattctcttcctcaacaagcaagacctgcttgctgagaaa
gtcctcgctggcaaatcgaagattgaggactactttccagagttcgctcgctacaccact
cctgaggatgcgactcccgagccgggagaggacccacgcgtgacccgggccaagtacttc
attcgggatgagtttctgagaatcagcactgctagtggagatgggcgccactactgctac
cctcactttacctgcgccgtggacactgagaacatccgccgtgtcttcaacgactgccgt
gacatcatccagcgcatgcatctccgccaatacgagctgctctaa

DBGET integrated database retrieval system