KEGG   Mus musculus (house mouse): 14686
Entry
14686             CDS       T01002                                 
Symbol
Gnat2, AW490837, Gnat-2, Gt-2, Hg1d, Tcalpha
Name
(RefSeq) guanine nucleotide binding protein, alpha transducing 2
  KO
K04631  guanine nucleotide-binding protein G(t) subunit alpha 1/2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    14686 (Gnat2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    14686 (Gnat2)
GTP-binding proteins [BR:mmu04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    14686 (Gnat2)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA DAP3 AAA_29 TniB
Other DBs
NCBI-GeneID: 14686
NCBI-ProteinID: NP_032167
MGI: 95779
Ensembl: ENSMUSG00000009108
UniProt: P50149 A2AE33
Position
3:107994120..108008748
AA seq 354 aa
MGSGISAEDKELARRSKELEKKLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKIIHQDG
YSPEECLEFKSVIYGNVLQSILAIIRAMSTLGIDYAEPSCADAGRQLNNLADSTEEGTMP
PELVDVIRKLWKDGGVQACFDRAAEFQLNDSASYYLNQLDRITDPNYLPNEQDVLRSRVK
TTGIIETKFSVKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDDEV
NRMHESLHLFNSICNHKFFAATSIVLFLNKKDLFEEKIKKVHLSICFPEYDGNNSYEDAG
NYIKSQFLDLNMRKDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggggagtggcatcagtgctgaggacaaagaacttgccaggaggtccaaggagctggag
aagaagctgcaggaggatgctgacaaggaagccaagactgtcaagctgctgttgctcggt
gcgggcgagtcagggaagagcactatcgtcaaacagatgaagatcattcaccaggatggc
tactcacccgaagagtgcctagagttcaagtctgtcatctatgggaacgtgctgcagtcc
atcctggccatcatcagagccatgtccacactaggcattgactatgcagagccaagctgt
gcggatgccgggagacagctcaacaacctggctgactccaccgaggaggggaccatgcct
cctgagttggtggacgtcatcaggaagttgtggaaggacggtggagttcaagcctgcttt
gacagagctgcagagttccagctcaatgactcggcatcttactacctgaaccagctggac
cggattacagaccctaactacctccctaacgagcaggacgtgcttcgatccagagtcaag
acaacaggcatcatcgagaccaagttttctgttaaagatttgaatttcaggatgtttgat
gtgggagggcagagatcagagaggaagaaatggatccactgcttcgagggagtcacctgc
atcattttctgtgcggccctcagtgcctacgacatggtgctggtggaggatgacgaagtg
aatcgcatgcacgagtctttgcatctgttcaacagcatctgcaaccacaagttctttgcg
gctacgtccatcgttctctttctcaacaagaaggacctctttgaggaaaaaattaagaaa
gtccacctcagtatctgttttccggagtatgacggaaacaactcctatgaggatgccggg
aattatatcaagagtcagttccttgacctcaacatgaggaaagatgtcaaagaaatctac
agtcacatgacctgtgctacagacacacagaacgtcaaattcgtgttcgatgcagttaca
gacatcatcatcaaagaaaacctcaaggactgtgggctcttttaa

DBGET integrated database retrieval system