KEGG   Mus musculus (mouse): 14687
Entry
14687             CDS       T01002                                 

Symbol
Gnaz, AI847979, Gz
Name
(RefSeq) guanine nucleotide binding protein, alpha z subunit
  KO
K04535  guanine nucleotide-binding protein G(z) subunit alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04730  Long-term depression
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04730 Long-term depression
    14687 (Gnaz)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    14687 (Gnaz)
GTP-binding proteins [BR:mmu04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    14687 (Gnaz)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB AAA_29
Other DBs
NCBI-GeneID: 14687
NCBI-ProteinID: NP_034441
MGI: 95780
Ensembl: ENSMUSG00000040009
Vega: OTTMUSG00000033002
UniProt: O70443 Q542R8
Position
10 B5.3; 10 38.48 cM
AA seq 355 aa
MGCRQSSEEKEAARRSRRIDRHLRSESQRQRREIKLLLLGTSNSGKSTIVKQMKIIHSGG
FNLDACKEYKPLIIYNAIDSLTRIIRALAALKIDFHNPDRAYDAVQLFALTGPAESKGEI
TPELLGVMRRLWADPGAQACFGRSSEYHLEDNAAYYLNDLERIAAPDYIPTVEDILRSRD
MTTGIVENKFTFKELTFKMVDVGGQRSERKKWIHCFEGVTAIIFCVELSGYDLKLYEDNQ
TSRMAESLRLFDSICNNNWFINTSLILFLNKKDLLAEKIRRIPLSVCFPEYKGQNTYEEA
AVYIQRQFEDLNRNKETKEIYSHFTCATDTSNIQFVFDAVTDVIIQNNLKYIGLC
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgggatgtcggcaaagctcagaggaaaaagaggcagcgaggcggtcccggagaattgac
cgccacctgcgctccgaaagccagcggcagcgccgtgaaatcaaacttctcctgctgggc
accagcaactcgggcaagagcaccatcgtcaagcagatgaagatcatccacagcgggggc
ttcaacctggacgcctgcaaggagtacaagcccctcatcatctacaacgccatcgactcg
ctgacccggatcatccgggccctggctgccctcaagatcgatttccacaaccctgaccgt
gcctacgacgctgtgcagctctttgctctgactggcccagcagagagcaagggtgagatt
acacctgagctgctgggtgtcatgcgacggctctgggctgacccaggggcccaggcctgc
tttggccgctctagcgagtaccacctggaggacaatgcagcctactacctgaacgacctg
gagcgcatcgcagcgcccgactacatccccacggtggaggatatcctacgctcccgggac
atgaccacgggcattgtggagaacaagttcaccttcaaggagcttaccttcaagatggtg
gacgtgggcgggcagaggtcagaacgcaaaaagtggatccattgctttgaaggcgtcaca
gccatcatcttctgtgtggagctcagtggctatgacctgaagctctatgaggacaaccag
acgagccggatggcggagagcctgcgcctctttgactccatctgcaacaacaactggttc
atcaacacctcgctcatcctcttcctgaacaagaaggacctcctggcagagaagatccgg
cgtatcccgctcagcgtctgcttcccagagtacaagggtcagaacacgtacgaggaagcc
gcggtctacatccaacgtcagttcgaggacctcaaccgcaacaaggagaccaaggagatc
tattcgcacttcacttgtgccaccgacaccagtaacatccagtttgtgtttgacgcagtg
acagatgtcatcatacagaacaatctcaagtacatcggcctttgctga

DBGET integrated database retrieval system