KEGG   Mus musculus (mouse): 14699
Entry
14699             CDS       T01002                                 

Symbol
Gngt1, G(y)1, Gng1, Hg3g1
Name
(RefSeq) guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1
  KO
K04548  guanine nucleotide-binding protein G(T) subunit gamma-T1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
mmu04062  Chemokine signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04371  Apelin signaling pathway
mmu04713  Circadian entrainment
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04726  Serotonergic synapse
mmu04727  GABAergic synapse
mmu04728  Dopaminergic synapse
mmu04744  Phototransduction
mmu04926  Relaxin signaling pathway
mmu05032  Morphine addiction
mmu05034  Alcoholism
mmu05163  Human cytomegalovirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    14699 (Gngt1)
   04371 Apelin signaling pathway
    14699 (Gngt1)
   04151 PI3K-Akt signaling pathway
    14699 (Gngt1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    14699 (Gngt1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    14699 (Gngt1)
  09156 Nervous system
   04724 Glutamatergic synapse
    14699 (Gngt1)
   04727 GABAergic synapse
    14699 (Gngt1)
   04725 Cholinergic synapse
    14699 (Gngt1)
   04728 Dopaminergic synapse
    14699 (Gngt1)
   04726 Serotonergic synapse
    14699 (Gngt1)
   04723 Retrograde endocannabinoid signaling
    14699 (Gngt1)
  09157 Sensory system
   04744 Phototransduction
    14699 (Gngt1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    14699 (Gngt1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14699 (Gngt1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    14699 (Gngt1)
   05163 Human cytomegalovirus infection
    14699 (Gngt1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    14699 (Gngt1)
  09165 Substance dependence
   05032 Morphine addiction
    14699 (Gngt1)
   05034 Alcoholism
    14699 (Gngt1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    14699 (Gngt1)
GTP-binding proteins [BR:mmu04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    14699 (Gngt1)
SSDB
Motif
Pfam: G-gamma DUF2508
Other DBs
NCBI-GeneID: 14699
NCBI-ProteinID: NP_034444
MGI: 109165
Ensembl: ENSMUSG00000029663
Vega: OTTMUSG00000034241
UniProt: Q61012
Position
6:3989082..3997441
AA seq 74 aa
MPVINIEDLTEKDKLKMEVDQLKKEVTLERMMVSKCCEEVRDYIEERSGEDPLVKGIPED
KNPFKELKGGCVIS
NT seq 225 nt   +upstreamnt  +downstreamnt
atgccagtgatcaacatcgaagacctgacagaaaaggacaagttgaagatggaggtagac
cagcttaagaaggaagtgacactggagagaatgatggtttccaaatgttgtgaagaagtg
agagattatattgaagaaaggtctggagaagaccctctagtgaaggggattccagaagac
aaaaaccccttcaaggaactcaaaggaggctgtgtgatttcatag

DBGET integrated database retrieval system