KEGG   Mus musculus (house mouse): 14705
Entry
14705             CDS       T01002                                 
Symbol
Bscl2, 2900097C17Rik, AI046355, Gng3lg
Name
(RefSeq) Berardinelli-Seip congenital lipodystrophy 2 (seipin)
  KO
K19365  seipin
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99983 Lipid metabolism
    14705 (Bscl2)
SSDB
Motif
Pfam: Seipin
Other DBs
NCBI-GeneID: 14705
NCBI-ProteinID: NP_001277752
MGI: 1298392
Ensembl: ENSMUSG00000071657
UniProt: Q9Z2E9
Position
19:8814831..8826047
AA seq 383 aa
MVNDPPVPALLWAQEVGHVLAGRARRLMLQFGVLFCTILLLLWVSVFLYGSFYYSYMPTV
SHLSPVHFHYRTDCDSSTASLCSFPVANVSLAKSGRDRVLMYGQPYRVTLELELPESPVN
QDLGMFLVTVSCYTRGGRIISTSSRSVMLHYRSQLLQVLDTLLFSSLLLFGFAEQKQLLE
VELYSDYRENSYVPTTGAIIEIHSKRIQMYGAYLRIHAHFTGLRYLLYNFPMTCAFVGVA
SNFTFLSVIVLFSYMQWVWGAVWPRHRFSLQVNIRQRDNSHHGAPRRISRHQPGQESTQQ
SDVTEDGESPEDPSGTEGQLSEEEKPEKRPLNGEEEQEPEASDGSWEDAALLTEANPPTS
ASASALAPETLGSLRQRPTCSSS
NT seq 1152 nt   +upstreamnt  +downstreamnt
atggtcaatgacccaccagtccccgccttactgtgggcccaggaagtgggccacgtcttg
gcaggccgtgcccgcaggctgatgctgcagtttggggtgctcttctgcaccatccttctt
ttgctttgggtgtctgtgttcctctatggctccttctactactcctacatgccgacggtc
agccacctcagccctgtgcacttccactacaggacagactgtgattcctccaccgcctct
ctctgctctttccctgttgccaatgtctcactggctaagagtggacgtgatcgggtactg
atgtatggacagccatatcgagtcaccttagagcttgaactgcccgaatcccctgtgaat
caagacttgggcatgttcttagtcactgtttcatgttataccagaggtggccgaatcatc
tccacttcttcacgctcagtgatgctgcattaccgctcgcagctgctccaggtgctcgac
acgctgctgttctccagcctcctgctgtttggcttcgctgaacagaagcagctcctggaa
gtagaactctactctgactatagggagaattcgtatgtgccaacaactggagcaattatt
gagatccacagcaagcgcatccagatgtatggagcctacctccggatccatgcccacttc
actgggctcaggtacctgctgtacaacttccccatgacctgcgccttcgtgggtgtggcc
agcaacttcacgttcctcagcgtcatcgtgctcttcagctatatgcagtgggtgtggggt
gctgtctggccccgccaccgcttctctctgcaggttaatatccgacaaagggataactca
caccacggggccccgcgtcggatctcgcgccatcagccaggtcaggaatctacccagcag
tcggatgtgacggaggatggtgagagccctgaagatccctcaggaacagagggccagctg
tctgaggaagagaaaccagagaagcggcccctgaatggagaggaggagcaagagccagag
gctagtgatggctcctgggaagatgcagctttgctgacagaggccaacccacctacctct
gcctcagcatctgcccttgcccctgagactctgggtagcctcaggcaacgcccgacctgc
tccagttcctga

DBGET integrated database retrieval system