KEGG   Mus musculus (mouse): 14708
Entry
14708             CDS       T01002                                 

Symbol
Gng7, AI840417
Name
(RefSeq) guanine nucleotide binding protein (G protein), gamma 7
  KO
K04543  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
mmu04062  Chemokine signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04371  Apelin signaling pathway
mmu04713  Circadian entrainment
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04726  Serotonergic synapse
mmu04727  GABAergic synapse
mmu04728  Dopaminergic synapse
mmu04740  Olfactory transduction
mmu04926  Relaxin signaling pathway
mmu05032  Morphine addiction
mmu05034  Alcoholism
mmu05163  Human cytomegalovirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    14708 (Gng7)
   04371 Apelin signaling pathway
    14708 (Gng7)
   04151 PI3K-Akt signaling pathway
    14708 (Gng7)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    14708 (Gng7)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    14708 (Gng7)
  09156 Nervous system
   04724 Glutamatergic synapse
    14708 (Gng7)
   04727 GABAergic synapse
    14708 (Gng7)
   04725 Cholinergic synapse
    14708 (Gng7)
   04728 Dopaminergic synapse
    14708 (Gng7)
   04726 Serotonergic synapse
    14708 (Gng7)
   04723 Retrograde endocannabinoid signaling
    14708 (Gng7)
  09157 Sensory system
   04740 Olfactory transduction
    14708 (Gng7)
  09159 Environmental adaptation
   04713 Circadian entrainment
    14708 (Gng7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14708 (Gng7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    14708 (Gng7)
   05163 Human cytomegalovirus infection
    14708 (Gng7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    14708 (Gng7)
  09165 Substance dependence
   05032 Morphine addiction
    14708 (Gng7)
   05034 Alcoholism
    14708 (Gng7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14708 (Gng7)
   04031 GTP-binding proteins [BR:mmu04031]
    14708 (Gng7)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   14708 (Gng7)
  Exosomal proteins of other body fluids (saliva and urine)
   14708 (Gng7)
GTP-binding proteins [BR:mmu04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    14708 (Gng7)
SSDB
Motif
Pfam: G-gamma CP12 DUF5763 FtsX_ECD
Other DBs
NCBI-GeneID: 14708
NCBI-ProteinID: NP_001033744
MGI: 95787
Ensembl: ENSMUSG00000048240
Vega: OTTMUSG00000030294
UniProt: Q3UGN1 G3X9Q2
Position
10 C1; 10 39.72 cM
AA seq 69 aa
MMSGTNNVAQARKLVEQLRIEAGIERIKVSKASSDLMGYCEQHARNDPLLVGVPASENPF
KDKKPCIIL
NT seq 210 nt   +upstreamnt  +downstreamnt
atgatgtcaggtactaacaacgtcgcccaggcccggaagctggtggagcagctgcgcatt
gaagctgggatcgaacgcatcaaggtctccaaggcctcgtcagacctgatgggctactgt
gagcaacatgcccgcaacgatcccttgctggttggcgtgccagcctctgagaatccattc
aaagacaaaaagccttgcataattctctag

DBGET integrated database retrieval system