KEGG   Mus musculus (mouse): 14715
Entry
14715             CDS       T01002                                 

Gene name
Gnrhr
Definition
(RefSeq) gonadotropin releasing hormone receptor
  KO
K04280  gonadotropin-releasing hormone receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14715 (Gnrhr)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    14715 (Gnrhr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    14715 (Gnrhr)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Gonadotropin-releasing hormone (GnRH)
    14715 (Gnrhr)
SSDB
Motif
Pfam: 7tm_1 Spo7
Other DBs
NCBI-GeneID: 14715
NCBI-ProteinID: NP_034453
MGI: 95790
Ensembl: ENSMUSG00000029255
Vega: OTTMUSG00000025622
UniProt: Q01776
Position
5 E1; 5 43.56 cM
AA seq 327 aa
MANNASLEQDPNHCSAINNSIPLIQGKLPTLTVSGKIRVTVTFFLFLLSTAFNASFLLKL
QKWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYL
KLFSMYAPAFMMVVISLDRSLAITQPLAVQSNSKLEQSMISLAWILSIVFAGPQLYIFRM
IYLADGSGPTVFSQCVTHCSFPQWWHQAFYNFFTFGCLFIIPLLIMLICNAKIIFALTRV
LHQDPRKLQLNQSKNNIPRARLRTLKMTVAFATSFVVCWTPYYVLGIWYWFDPEMLNRVS
EPVNHFFFLFAFLNPCFDPLIYGYFSL
NT seq 984 nt   +upstreamnt  +downstreamnt
atggctaacaatgcatctcttgagcaggacccaaatcactgctcggccatcaacaacagc
atccccttgatacagggcaagctcccgactctaaccgtatctggaaagatccgagtgacc
gtgactttcttccttttcctactctctactgccttcaatgcttccttcttgttgaagctg
cagaagtggactcagaagaggaagaaaggaaaaaagctctcaaggatgaaggtgctttta
aagcatttgaccttagccaacctgctggagactctgatcgtcatgccactggatgggatg
tggaatattactgttcagtggtatgctggggagttcctctgcaaagttctcagctatctg
aagctcttctctatgtatgccccagctttcatgatggtggtgattagcctggaccgctcc
ctggccatcactcagccccttgctgtacaaagcaacagcaagcttgaacagtctatgatc
agcctggcctggattctcagcattgtctttgcaggaccacagttatatatcttcaggatg
atctacctagcagacggctctgggcccacagtcttctcgcaatgtgtgacccactgcagc
tttccacagtggtggcatcaggccttctacaactttttcaccttcggctgcctcttcatc
atccccctcctcatcatgctaatctgcaatgccaaaatcatctttgctctcacgcgagtc
cttcatcaagacccacgcaaactacagctgaatcagtccaagaataatatcccaagagct
cggctgagaacgctaaagatgacagtcgcattcgctacctcctttgtcgtctgctggact
ccctactatgtcctaggcatttggtactggtttgatccagaaatgttgaacagggtgtca
gagccagtgaatcactttttctttctctttgctttcctaaacccgtgcttcgacccactc
atatatgggtatttctctttgtag

DBGET integrated database retrieval system