KEGG   Mus musculus (mouse): 14723
Entry
14723             CDS       T01002                                 

Gene name
Gp1ba, GP, GP-Ib_alpha, GPIb, GPIba, GPIbalpha
Definition
(RefSeq) glycoprotein 1b, alpha polypeptide
  KO
K06261  platelet glycoprotein Ib alpha chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04512  ECM-receptor interaction
mmu04611  Platelet activation
mmu04613  Neutrophil extracellular trap formation
mmu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    14723 (Gp1ba)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    14723 (Gp1ba)
   04611 Platelet activation
    14723 (Gp1ba)
   04613 Neutrophil extracellular trap formation
    14723 (Gp1ba)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    14723 (Gp1ba)
CD molecules [BR:mmu04090]
 Proteins
  14723 (Gp1ba)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_9 LRRNT Cornifin
Other DBs
NCBI-GeneID: 14723
NCBI-ProteinID: NP_034456
MGI: 1333744
Ensembl: ENSMUSG00000050675
Vega: OTTMUSG00000006072
UniProt: O35930 A2CFB8
Structure
PDB: 
6EJX

Position
11 B3; 11 43.2 cM
AA seq 734 aa
MALLILLFLLPSPLHSQHTCSISKVTSLLEVNCENKKLTALPADLPADTGILHLGENQLG
TFSTASLVHFTHLTYLYLDRCELTSLQTNGKLIKLENLDLSHNNLKSLPSLGWALPALTT
LDVSFNKLGSLSPGVLDGLSQLQELYLQNNDLKSLPPGLLLPTTKLKKLNLANNKLRELP
SGLLDGLEDLDTLYLQRNWLRTIPKGFFGTLLLPFVFLHANSWYCDCEILYFRHWLQENA
NNVYLWKQGVDVKDTTPNVASVRCANLDNAPVYSYPGKGCPTSSGDTDYDDYDDIPDVPA
TRTEVKFSTNTKVHTTHWSLLAAAPSTSQDSQMISLPPTHKPTKKQSTFIHTQSPGFTTL
PETMESNPTFYSLKLNTVLIPSPTTLEPTSTQATPEPNIQPMLTTSTLTTPEHSTTPVPT
TTILTTPEHSTIPVPTTAILTTPKPSTIPVPTTATLTTLEPSTTPVPTTATLTTPEPSTT
LVPTTATLTTPEHSTTPVPTTATLTTPEHSTTPVPTTATLTTPEPSTTLTNLVSTISPVL
TTTLTTPESTPIETILEQFFTTELTLLPTLESTTTIIPEQNSFLNLPEVALVSSDTSESS
PFLNSDFCCFLPLGFYVLGLLWLLFASVVLILLLTWTWHVTPHSLDMEQSAALATSTHTT
SLEVQRARQVTMPRAWLLFLQGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQD
LLGTVGIRYSGHSL
NT seq 2205 nt   +upstreamnt  +downstreamnt
atggctctcctcatcttgctcttcctgctgccaagtcccttgcattcccagcacacttgt
agtatctccaaagtgaccagcctgctggaagtaaactgtgagaacaagaagctgacagca
ctgcctgcagacctgccagcagacacaggcatcctccacctgggcgagaaccaactgggt
accttctccacagcatcactggtgcatttcactcacctcacttatctgtacctggataga
tgtgagctgacgagcctgcagaccaatggtaaactgataaagctggaaaacctggactta
tcccataataacctgaaaagcctgccctccctaggatgggcattgcctgcactcactact
ctagacgtctccttcaacaagttgggctcactgtctcctggtgtcctggatggcctaagc
caactccaagagctctacttgcagaacaatgatcttaagagtctgccccccgggctcttg
ttgccaacgaccaagctgaagaaactcaatctggccaacaacaaattgcgtgagctgccc
tctgggctcctagatgggctggaggatcttgataccctctaccttcaaaggaactggctt
cgcacaataccaaagggcttctttgggaccctcctcttgccttttgtttttctccacgcc
aacagctggtactgtgattgtgaaatcctctacttccgtcactggctccaggaaaatgcc
aacaatgtctacttatggaagcagggtgtggatgtcaaggacacaactcctaacgtggcc
agtgtacgatgtgccaacttggacaatgcgcctgtctactcctacccagggaagggctgc
cctactagtagtggtgacacagactatgatgactatgatgatatccctgacgtccctgcc
acaagaactgaggtcaagttctctactaacactaaagttcatactacccactggagccta
ctcgccgcagcaccttctacttctcaagacagccaaatgatttctttgcctccaactcat
aaacccactaagaaacaatctacattcatccacacacagagcccaggtttcaccacactc
ccagagaccatggaatctaacccaaccttctacagtctaaaactcaatactgtactcatc
ccctccccaaccaccctagagcccacctccacccaggctaccccagagcccaacatccaa
ccaatgcttaccacctccaccctgactaccccagagcacagcaccaccccagtgcccact
actaccatcctgacaaccccagagcacagcaccatcccagtgcccactactgccatcctg
actaccccaaagcccagcaccatcccagtgcccactactgccaccctgactaccctagag
cccagcaccaccccagtgcccactactgccaccttaactaccccagagcccagcaccacc
ctggtacccactactgccaccctgactaccccagagcacagcaccaccccagtgcccact
actgccactctgactaccccagagcacagcaccaccccagtgcccactactgccaccctg
actaccccagagcccagcaccactttaactaatctagtgtccactatctccccagtgctc
actaccaccctgaccactccagagtctaccccaattgagacaattttagaacaatttttt
accacagagctcactttactccctaccttagaatccaccaccacaataatcccagagcag
aacagctttctcaatctcccagaggtagctctagtaagctctgatacttctgaaagcagt
ccttttctcaattctgacttttgctgcttcctccccctgggcttctatgtccttggtctc
ctctggctcctatttgcctctgtggtcctcatcttgttgctgacctggacctggcatgtg
acaccacatagtctggacatggaacaatctgctgcattggccacaagcactcacaccaca
agcctggaggtgcagagggcaaggcaagtaactatgccccgggcctggctgctcttcctt
caaggatcactccctactttccggtctagccttttcctgtgggtaaggcctaatgggcga
gtggggcctctggtagcaggacggcgaccctcagctctgagtcagggtcgtggtcaggac
ctattgggcacagtgggcattaggtactcaggccatagtctgtga

DBGET integrated database retrieval system