KEGG   Mus musculus (mouse): 14724
Entry
14724             CDS       T01002                                 

Gene name
Gp1bb
Definition
(RefSeq) glycoprotein Ib, beta polypeptide
  KO
K06262  platelet glycoprotein Ib beta chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04512  ECM-receptor interaction
mmu04611  Platelet activation
mmu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    14724 (Gp1bb)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    14724 (Gp1bb)
   04611 Platelet activation
    14724 (Gp1bb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    14724 (Gp1bb)
CD molecules [BR:mmu04090]
 Proteins
  14724 (Gp1bb)
SSDB
Motif
Pfam: LRRNT LRRCT LRR_8
Other DBs
NCBI-GeneID: 14724
NCBI-ProteinID: NP_034457
MGI: 107852
Ensembl: ENSMUSG00000050761
UniProt: P56400
Position
16 A3; 16 11.53 cM
AA seq 206 aa
MGSRPRGALSLLLLLLALLSRPASGCPAPCSCAGTLVDCGRRGLTWASLPAAFPPDTTEL
VLTGNNLTALPPGLLDALPALRAAHLGANPWRCDCRLLPLRAWLAGRPERAPYRDLRCVA
PPALRGRLLPYVAEDELRAACAPGLLCWGALVAQLALLVLGLLHALLLALLLGRLRRLRA
RARARSIQEFSLTAPLVAESARGGAS
NT seq 621 nt   +upstreamnt  +downstreamnt
atgggctcccggccccgtggggcgctgagcctgctgcttctgttgctagcgctgctcagc
cgcccagcctctggctgccccgcgccatgcagctgcgcagggacgctcgtggactgtggg
cgccgcgggctgacctgggcgtcgctgccggctgccttccctcccgacaccaccgaattg
gtgctgaccggcaacaacctgacggcgctgccgcccgggcttctggacgcgttgcctgct
ctgcgcgcagcacacctgggcgccaacccctggcgctgcgactgccgcctattgccgctg
cgcgcctggctggccggccgcccggagcgcgcgccctaccgcgacctgcgctgtgtcgcg
cccccagcgctgcgcggccgcttgctgccctacgtggcggaggatgagctgcgggccgcg
tgcgcacccggtctactctgctggggagcactggtggcccagctagcactgctggtcctc
gggctgctacacgcgctgctattggcacttctactaggtcgcctgcggaggctgcgcgcg
cgtgcgcgcgcacgctccatccaagagttctctctcacagccccgctggtggccgagtcg
gccagaggtggtgcatcctaa

DBGET integrated database retrieval system