KEGG   Mus musculus (house mouse): 14726
Entry
14726             CDS       T01002                                 
Symbol
Pdpn, E11, Gp38, OTS-8, RANDAM-2, T1-alpha, T1a, T1alpha
Name
(RefSeq) podoplanin
  KO
K16778  podoplanin
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    14726 (Pdpn)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    14726 (Pdpn)
SSDB
Motif
Pfam: Podoplanin Endomucin Glycophorin_A DUF5305 DUF2970
Other DBs
NCBI-GeneID: 14726
NCBI-ProteinID: NP_034459
MGI: 103098
Ensembl: ENSMUSG00000028583
UniProt: Q62011
Structure
Position
4:complement(142993979..143026134)
AA seq 172 aa
MWTVPVLFWVLGSVWFWDSAQGGTIGVNEDDIVTPGTGDGMVPPGIEDKITTTGATGGLN
ESTGKAPLVPTQRERGTKPPLEELSTSATSDHDHREHESTTTVKVVTSHSVDKKTSHPNR
DNAGDETQTTDKKDGLPVVTLVGIIVGVLLAIGFVGGIFIVVMKKISGRFSP
NT seq 519 nt   +upstreamnt  +downstreamnt
atgtggaccgtgccagtgttgttctgggttttggggagcgtttggttctgggactctgcg
cagggagggactataggcgtgaatgaagatgatattgtgaccccaggtacaggagacggc
atggtgcccccaggtatagaagacaaaataacaaccacaggtgctactggagggcttaat
gaatctactggcaaggcacctctggtaccaacgcagagagagcgtgggacgaagcctccc
ttagaggaactgtccacctcagcaacctcagaccatgatcacagagaacacgagagtaca
accactgtcaaagtggtgactagccactctgtggacaagaaaacaagtcaccccaataga
gataatgcaggggatgaaacgcagacaacagataagaaagatggcttgccagtagtcacc
ctggttggaatcatagttggcgtcttgttagccattggcttcgtcggagggatcttcatt
gttgttatgaagaagatttctggaaggttctcgccctaa

DBGET integrated database retrieval system