KEGG   Mus musculus (mouse): 14729
Entry
14729             CDS       T01002                                 

Gene name
Gp5, G, GPV
Definition
(RefSeq) glycoprotein 5 (platelet)
  KO
K06260  platelet glycoprotein V
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04512  ECM-receptor interaction
mmu04611  Platelet activation
mmu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    14729 (Gp5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    14729 (Gp5)
   04611 Platelet activation
    14729 (Gp5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    14729 (Gp5)
CD molecules [BR:mmu04090]
 Proteins
  14729 (Gp5)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 LRRCT GST_C_2
Other DBs
NCBI-GeneID: 14729
NCBI-ProteinID: NP_032174
MGI: 1096363
Ensembl: ENSMUSG00000047953
UniProt: Q9QZU3
Position
16; 16 B2
AA seq 567 aa
MLRSALLSAVLALLRAQPFPCPKTCKCVVRDAAQCSGGSVAHIAELGLPTNLTHILLFRM
DQGILRNHSFSGMTVLQRLMLSDSHISAIDPGTFNDLVKLKTLRLTRNKISRLPRAILDK
MVLLEQLFLDHNALRDLDQNLFQQLRNLQELGLNQNQLSFLPANLFSSLRELKLLDLSRN
NLTHLPKGLLGAQVKLEKLLLYSNQLTSVDSGLLSNLGALTELRLERNHLRSVAPGAFDR
LGNLSSLTLSGNLLESLPPALFLHVSSVSRLTLFENPLEELPDVLFGEMAGLRELWLNGT
HLSTLPAAAFRNLSGLQTLGLTRNPRLSALPRGVFQGLRELRVLALHTNALAELRDDALR
GLGHLRQVSLRHNRLRALPRTLFRNLSSLESVQLEHNQLETLPGDVFAALPQLTQVLLGH
NPWLCDCGLWPFLQWLRHHPDILGRDEPPQCRGPEPRASLSFWELLQGDPWCPDPRSLPL
DPPTENALEAPVPSWLPNSWQSQTWAQLVARGESPNNRLYWGLYILLLVAQAIIAAFIVF
AMIKIGQLFRTLIREKLLLEAMGKSCN
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgctaagaagcgccctgctgtccgcggtgctcgcactcttgcgtgcccaaccttttccc
tgccccaaaacctgcaagtgtgtggtccgcgatgccgcgcagtgctcgggcggcagcgtg
gctcacatcgctgagctaggtctgcctacgaacctcacacacatcctgctcttccgaatg
gaccagggcatattgcggaaccacagcttcagcggcatgacagtccttcagcgcctgatg
ctctcagatagccacatttccgccatcgaccccggcaccttcaatgacctggtaaaactg
aaaaccctcaggttgacgcgcaacaaaatctctcgtcttccacgtgcgatcctggataag
atggtactcttggaacagctgttcttggaccacaatgcactaagggaccttgatcaaaac
ctgtttcagcaactgcgtaaccttcaggagctcggtttgaaccagaatcagctctctttt
cttcctgctaaccttttctcgagcctgagagaactgaagttgttggatttatcgcgaaac
aacctgacccacctgcccaagggactgcttggggctcaagttaagcttgagaaactgctg
ctctattcaaaccagctcacgtctgtggattcggggctgctgagcaacctgggcgccctg
actgagctgcggctggagcggaatcacctccgctccgtagccccgggtgccttcgaccgc
ctcggaaacctgagctccttgactctatccggaaacctcctggagtctctgccgcccgcg
ctcttccttcacgtgagcagcgtgtctcggctgactctgttcgagaaccccctggaggag
ctcccggacgtgttgttcggggagatggccggcctgcgggagctgtggctgaacggcacc
cacctgagcacgctgcccgccgctgccttccgcaacctgagcggcttgcagacgctgggg
ctgacgcggaacccgcgcctgagcgcgctcccgcgcggcgtgttccagggcctacgggag
ctgcgcgtgctcgcgctgcacaccaacgccctggcggagctgcgggacgacgcgctgcgc
ggcctcgggcacctgcgccaggtgtcgctgcgccacaaccggctgcgggccctgccccgc
acgctcttccgcaacctcagcagcctcgagagcgtgcagctagagcacaaccagctggag
acgctgccaggagacgtgttcgcggctctgccccagctgacccaggtcctgctgggtcac
aacccctggctctgcgactgtggcctgtggcccttcctccagtggctgcggcatcacccg
gacatcctgggccgagacgagcccccgcagtgccgtggcccggagccacgcgccagcctg
tcgttctgggagctgctgcagggtgacccgtggtgcccggatcctcgcagcctgcctctc
gaccctccaaccgaaaatgctctggaagccccggttccgtcctggctgcctaacagctgg
cagtcccagacgtgggcccagctggtggccaggggtgaaagtcccaataacaggctctac
tggggtctttatattctgcttctagtagcccaggccatcatagccgcgttcatcgtgttt
gccatgattaaaatcggccagctgtttcgaacattaatcagagagaagctcttgttagag
gcaatgggaaaatcgtgtaactaa

DBGET integrated database retrieval system