KEGG   Mus musculus (mouse): 14734
Entry
14734             CDS       T01002                                 

Gene name
Gpc3, OCI, OCI-5
Definition
(RefSeq) glypican 3
  KO
K08109  glypican 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    14734 (Gpc3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    14734 (Gpc3)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    14734 (Gpc3)
Proteoglycans [BR:mmu00535]
 Cell surface proteoglycans
  Glypican family (GPI-anchored HSPG)
   14734 (Gpc3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Others
  14734 (Gpc3)
SSDB
Motif
Pfam: Glypican
Other DBs
NCBI-GeneID: 14734
NCBI-ProteinID: NP_057906
MGI: 104903
Ensembl: ENSMUSG00000055653
Vega: OTTMUSG00000017333
UniProt: Q8CFZ4 Q3TWB2
Position
X; X A5
AA seq 579 aa
MAGTVRTACLLVAMLLGLGCLGQAQPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPGSD
LQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASMELKFLIIQNAAVFQEAFEIVVRH
AKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYTQ
MMNPGLPESVLDINECLRGARRDLKVFGSFPKLIMTQVSKSLQVTRIFLQALNLGIEVIN
TTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPCGGYCNVVMQGCMAGVVEIDKYWREYIL
SLEELVNGMYRIYDMENVLLGLFSTIHDSIQYVQKNGGKLTTTIGKLCAHSQQRQYRSAY
YPEDLFIDKKILKVAHVEHEETLSSRRRELIQKLKSFINFYSALPGYICSHSPVAENDTL
CWNGQELVERYSQKAARNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLRTMSVPKG
KVLDKSLDEEGLESGDCGDDEDECIGSSGDGMVKVKNQLRFLAELAYDLDVDDAPGNKQH
GNQKDNEITTSHSVGNMPSPLKILISVAIYVACFFFLVH
NT seq 1740 nt   +upstreamnt  +downstreamnt
atggccgggaccgtgcgcaccgcgtgcttgctggtggcgatgctgctaggcttgggctgc
ctgggacaggcgcagcccccgccgcctccagacgccacctgtcaccaggtccgttctttc
ttccagagactgcagcccggactcaaatgggttccagaaacccctgtaccaggatcagat
ttgcaagtatgtctccccaagggcccaacatgctgctcaagaaagatggaagaaaaatac
caactaacagcacggctgaacatggaacaactgctccagtctgcgagtatggaactcaag
ttcttaattattcagaatgctgcggttttccaagaggcctttgaaattgttgttcgccat
gccaagaactacaccaacgccatgttcaagaataactaccccagcctgactccacaagct
tttgagtttgtcggtgaatttttcacagatgtgtctctctacatcttgggttctgatatc
aacgtggatgatatggtcaatgaattgttcgacagcctctttccagtcatctacacccag
atgatgaacccaggcctgcctgagtcagtcttagacatcaacgagtgcctccgaggagca
agacgtgacctgaaagtatttggcagtttccccaagcttattatgacccaggtttccaag
tcactgcaagtcactcgaatcttccttcaagccctgaatctcggaattgaagtcatcaac
actaccgaccacctcaagtttagtaaggactgtggccgtatgctcacccgaatgtggtat
tgctcttactgccagggactgatgatggttaagccttgcggtggttattgcaatgtggtc
atgcaaggctgtatggctggtgtggtggagatcgacaagtactggagagaatacattctg
tctcttgaagagctcgtgaatggcatgtacagaatctacgacatggagaatgtgctgctc
ggcctcttttctaccatccatgattccatccagtatgtgcagaagaacggaggcaagctg
accaccaccattggcaagttgtgtgcccactcccagcaacgccaatatagatctgcttat
taccctgaagatctgtttattgacaagaagatattaaaagtcgctcatgtcgaacatgaa
gaaaccttatccagccgaagaagggaactgattcagaaactgaagtctttcatcaacttc
tatagcgctttgccgggctacatctgcagccatagccccgtggccgaaaatgataccctg
tgctggaacggacaagaacttgtggagagatacagccagaaggcggcaaggaacgggatg
aagaatcagtttaacctccatgagctgaaaatgaagggccctgagccggtggttagccag
atcattgacaaactgaagcacattaaccagctcctgagaaccatgtctgtgcccaagggt
aaagttctggataaaagcctggatgaagaaggacttgaaagtggagactgcggtgatgat
gaagatgaatgcattggaagctctggtgacgggatggtgaaagtgaagaatcaactgcgc
ttccttgcagaactggcctatgatctggatgtggacgatgctccggggaacaagcagcat
ggaaatcagaaggacaacgagatcaccacctctcacagcgtggggaacatgccgtcccca
ctgaagatcctcatcagtgtggccatctatgtggcgtgcttttttttcctggtgcactga

DBGET integrated database retrieval system