KEGG   Mus musculus (mouse): 14735Help
Entry
14735             CDS       T01002                                 

Gene name
Gpc4, 9530073D23Rik, AF311610, AI385680, AI661372, K-glypican
Definition
(RefSeq) glypican 4
  KO
K08110  glypican 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    14735 (Gpc4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    14735 (Gpc4)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    14735 (Gpc4)
Proteoglycans [BR:mmu00535]
 Cell surface proteoglycans
  Glypican family (GPI-anchored HSPG)
   14735 (Gpc4)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Others
  14735 (Gpc4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glypican DUF1910 Corona_6B_7B
Motif
Other DBs
NCBI-GeneID: 14735
NCBI-ProteinID: NP_032176
MGI: 104902
Ensembl: ENSMUSG00000031119
Vega: OTTMUSG00000017330
UniProt: P51655
Position
X A5; X 28.33 cM
AA seq 557 aa AA seqDB search
MARLGLLALLCTLAALSASLLAAELKSKSCSEVRRLYVSKGFNKNDAPLYEINGDHLKIC
PQDYTCCSQEMEEKYSLQSKDDFKTVVSEQCNHLQAIFASRYKKFDEFFKELLENAEKSL
NDMFVKTYGHLYMQNSELFKDLFVELKRYYVAGNVNLEEMLNDFWARLLERMFRLVNSQY
HFTDEYLECVSKYTEQLKPFGDVPRKLKLQVTRAFVAARTFAQGLAVARDVVSKVSVVNP
TAQCTHALLKMIYCSHCRGLVTVKPCYNYCSNIMRGCLANQGDLDFEWNNFIDAMLMVAE
RLEGPFNIESVMDPIDVKISDAIMNMQDNSVQVSQKVFQGCGPPKPLPAGRISRSISESA
FSARFRPYHPEQRPTTAAGTSLDRLVTDVKEKLKQAKKFWSSLPSTVCNDERMAAGNENE
DDCWNGKGKSRYLFAVTGNGLANQGNNPEVQVDTSKPDILILRQIMALRVMTSKMKNAYN
GNDVDFFDISDESSGEGSGSGCEYQQCPSEFEYNATDHSGKSANEKADSAGGAHAEAKPY
LLAALCILFLAVQGEWR
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcttaggcttgctcgcgctcctctgcaccctggccgcgctcagcgcctcgctg
ctggctgcggagctcaagtcgaaaagttgctcggaagtgcgacgtctctacgtgtccaaa
ggcttcaacaagaatgatgcccccctctatgagatcaacggtgaccatttgaagatctgt
ccccaggattatacatgctgttctcaagagatggaagagaagtacagcctgcaaagtaaa
gatgatttcaaaaccgtggtcagcgaacagtgcaaccatttgcaagccatctttgcatcc
cgttacaagaagtttgatgaattcttcaaagaacttcttgaaaatgcagagaaatccctg
aatgatatgttcgtgaagacatatggccacttatacatgcaaaattcagagctatttaaa
gatctcttcgttgagttgaagcgctactatgtggcgggaaatgtgaacctggaagaaatg
ttaaatgacttctgggctcgccttctggagcgcatgtttcgcctggtgaactcccagtac
cattttacagatgagtacttggaatgtgtgagcaaatatacagagcagctgaagcctttt
ggagatgtccctcggaaactgaagctccaggttacccgcgcatttgttgcagccaggacc
ttcgctcaaggcttagcagttgcaagggatgtagtaagcaaagtgtccgtggtgaacccc
acagctcagtgcacccatgcactgctgaagatgatctactgctcccactgccggggcctg
gtgactgtgaagccctgttacaactattgctcaaacatcatgcgaggctgtttggccaac
caaggagaccttgattttgagtggaacaatttcatagatgctatgctgatggtggcagag
aggctggagggtcctttcaacattgagtccgttatggatcccatcgatgtgaagatttct
gatgctatcatgaatatgcaggataatagtgttcaagtgtctcagaaggttttccaaggc
tgtggccctccgaagcctctcccagctggacgaatttctcgctccatctctgaaagtgcc
ttcagtgctcgattcagaccttatcatccagagcaacgcccaaccacggcagctggcact
agtttggaccgactggttactgatgtcaaggagaaactgaaacaagctaagaagttctgg
tcctctctcccaagcaccgtttgcaatgatgagaggatggcagcaggaaatgaaaatgag
gatgactgctggaatggcaaaggcaaaagcaggtacctgtttgcagtgacaggaaatgga
ttggccaaccagggcaacaacccagaagtccaggttgacaccagcaagccagacatactg
atccttcgtcagatcatggcccttcgggttatgaccagtaaaatgaagaatgcttacaat
ggaaatgacgtggacttctttgacatcagtgatgagagtagtggagagggaagtggaagc
ggatgtgaatatcagcagtgcccttcggagttcgagtacaacgccactgaccattctggg
aagagtgccaacgagaaagctgacagtgccggtggtgcccatgcagaggcaaagccctac
ctcctcgctgctctctgcatcctgtttctcgctgtgcagggagagtggagataa

DBGET integrated database retrieval system