KEGG   Mus musculus (mouse): 14744
Entry
14744             CDS       T01002                                 

Symbol
Gpr65, Dig1, Gpcr25, TDAG8
Name
(RefSeq) G-protein coupled receptor 65
  KO
K08416  psychosine receptor
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    14744 (Gpr65)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Others
   Proton-sensing GPCRs
    14744 (Gpr65)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 14744
NCBI-ProteinID: NP_032178
MGI: 108031
Ensembl: ENSMUSG00000021886
UniProt: Q61038 A0A0R4J0Y2 Q3UZ41 Q3UQ35
Position
12; 12 E
AA seq 337 aa
MAMNSMCIEEQRHLEHYLFPVVYIIVFIVSVPANIGSLCVSFLQAKKENELGIYLFSLSL
SDLLYALTLPLWINYTWNKDNWTFSPTLCKGSVFFTYMNFYSSTAFLTCIALDRYLAVVY
PLKFSFLRTRRFAFITSLSIWILESFFNSMLLWKDETSVEYCDSDKSNFTLCYDKYPLEK
WQINLNLFRTCMGYAIPLITIMICNHKVYRAVRHNQATENSEKRRIIKLLASITLTFVLC
FTPFHVMVLIRCVLERDMNVNDKSGWQTFTVYRVTVALTSLNCVADPILYCFVTETGRAD
MWNILKLCTRKHNRHQGKKRDILSVSTRDAVELEIID
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggcgatgaacagcatgtgcattgaagagcagcgccacctcgaacactatttgttcccg
gtggtctacataattgtgtttatagtcagcgtcccagccaacatcggatctttatgcgta
tcctttctgcaagcgaagaaggaaaatgagctagggatttacctcttcagtctgtccctg
tcagacctgctgtatgcgctgactctgcccctctggatcaattacacttggaataaagac
aactggactttctctcccaccttgtgcaaaggaagcgttttcttcacctacatgaacttt
tacagcagcacggcgttcctcacttgcattgccctggaccgctatttagcagtcgtctac
cctctgaagttttccttcctaagaacgagaagattcgcgtttattaccagcctctccatc
tggatattagagtccttctttaactctatgcttctgtggaaagatgaaacgagtgttgaa
tattgtgactcggacaaatctaatttcactctctgctatgacaaataccctctggagaaa
tggcagataaacctcaacctgtttcggacgtgcatgggctacgcaatacccttgatcacc
atcatgatctgcaaccataaagtctaccgagctgtgcggcacaaccaagccacggaaaac
agcgagaagagaaggatcataaagttgcttgctagcatcacgttgactttcgtcctatgc
tttacccccttccacgtgatggtgctcatccgctgcgttttagagcgcgacatgaacgtc
aatgacaagtctggatggcagacgtttacggtgtacagagtcacagtagccctgacgagt
ctaaactgtgttgccgatcccattctgtactgctttgtgactgagacggggagagctgat
atgtggaacatattaaaattgtgtactaggaaacacaatagacaccaagggaaaaaaagg
gacatactttctgtgtccacaagagatgctgtagaattagagattatagactaa

DBGET integrated database retrieval system