KEGG   Mus musculus (mouse): 14751
Entry
14751             CDS       T01002                                 

Gene name
Gpi1, Amf, Gpi, Gpi-1, Gpi-1r, Gpi-1s, Gpi-1t, Gpi1-r, Gpi1-s, Gpi1-t, Gpi1s, MF, NK, NK/GPI, Nlk, Org, Pgi, Phi
Definition
(RefSeq) glucose-6-phosphate isomerase 1
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00030  Pentose phosphate pathway
mmu00500  Starch and sucrose metabolism
mmu00520  Amino sugar and nucleotide sugar metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
Module
mmu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mmu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mmu_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    14751 (Gpi1)
   00030 Pentose phosphate pathway
    14751 (Gpi1)
   00500 Starch and sucrose metabolism
    14751 (Gpi1)
   00520 Amino sugar and nucleotide sugar metabolism
    14751 (Gpi1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14751 (Gpi1)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     14751 (Gpi1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   14751 (Gpi1)
  Exosomal proteins of other body fluids (saliva and urine)
   14751 (Gpi1)
  Exosomal proteins of colorectal cancer cells
   14751 (Gpi1)
SSDB
Motif
Pfam: PGI
Other DBs
NCBI-GeneID: 14751
NCBI-ProteinID: NP_032181
MGI: 95797
Ensembl: ENSMUSG00000036427
Vega: OTTMUSG00000008382
UniProt: P06745
Structure
PDB: 

Position
7 B1; 7 19.46 cM
AA seq 558 aa
MAALTRNPQFQKLLEWHRANSANLKLRELFEADPERFNNFSLNLNTNHGHILVDYSKNLV
NKEVMQMLVELAKSRGVEAARDNMFSGSKINYTENRAVLHVALRNRSNTPIKVDGKDVMP
EVNRVLDKMKSFCQRVRSGDWKGYTGKSITDIINIGIGGSDLGPLMVTEALKPYSKGGPR
VWFVSNIDGTHIAKTLASLSPETSLFIIASKTFTTQETITNAETAKEWFLEAAKDPSAVA
KHFVALSTNTAKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDHFEQLLSGA
HWMDQHFLKTPLEKNAPVLLALLGIWYINCYGCETHALLPYDQYMHRFAAYFQQGDMESN
GKYITKSGARVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGL
HHKILLANFLAQTEALMKGKLPEEARKELQAAGKSPEDLEKLLPHKVFEGNRPTNSIVFT
KLTPFILGALIAMYEHKIFVQGIMWDINSFDQWGVELGKQLAKKIEPELEGSSAVTSHDS
STNGLISFIKQQRDTKLE
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggctgcgctcacccggaacccgcagttccagaagctcctggagtggcaccgcgcgaac
tctgccaacctcaagctgcgcgaactttttgaggcggatccggagcgcttcaacaacttc
agcttgaacctcaacaccaaccatgggcatattctggtggactactccaagaaccttgtg
aacaaggaggtgatgcagatgctggtggagctggccaagtccagaggcgtggaggctgca
cgggacaacatgttcagtggttccaagatcaactacaccgagaatcgggcggtgctgcat
gtggcccttcggaaccggtccaacacacccatcaaggtggacggcaaagatgtgatgccg
gaggtgaacagggttctggacaagatgaagtctttctgccagcgggtccggagtggtgac
tggaaagggtacactggcaaatccatcacggacatcatcaacatcggcatcgggggctct
gacctgggacccctcatggtgactgaagctctcaagccttactcgaaaggaggtccccgt
gtctggtttgtctctaacattgatgggacccacattgccaaaacactggccagcttgtcc
cctgagacttccctctttataatcgcctccaagaccttcaccacccaggagaccatcacc
aatgcagagacagcaaaggagtggtttctcgaagcggccaaggatccatctgcagttgca
aagcactttgtcgccctgtctacgaacacggccaaagtgaaagagtttggaattgaccct
caaaacatgttcgagttctgggattgggtaggtggccgctattcgctgtggtcagccatt
ggactttccattgctctgcatgtaggttttgaccacttcgagcagctgctgtccggggct
cactggatggaccagcacttcctcaagacgcccctggagaagaatgcccccgtcctgctg
gctctactgggcatctggtacatcaactgctacggctgtgagacccacgccttgctgccc
tatgaccagtacatgcaccgctttgctgcctatttccagcagggtgacatggagtccaac
ggaaagtacatcaccaagtccggggcccgtgtggaccaccagacaggccccatcgtgtgg
ggggaaccagggaccaatggtcaacatgcattctaccagctcatccaccaaggcaccaag
atgataccctgtgactttctcatccctgtccagacccagcaccccatacggaaaggtctg
catcacaagatcctcctggctaacttcttggcccagactgaggccctgatgaaggggaag
ttgcctgaagaggccaggaaggagctccaggctgccggaaagagcccagaagacttggag
aaactcttgccacacaaggtctttgaaggaaaccgcccgaccaactctattgtgtttacc
aagctgacacccttcattctgggggccttgattgccatgtatgagcacaagatctttgtt
cagggcatcatgtgggacatcaacagcttcgaccagtggggagtggagctggggaagcag
ctggccaagaaaattgagccggagctggagggcagctctgctgtgacctcccatgattcc
tccactaacggactgatcagcttcatcaagcaacagcgggacaccaaactagaataa

DBGET integrated database retrieval system