KEGG   Mus musculus (mouse): 14756
Entry
14756             CDS       T01002                                 

Gene name
Gpld1, 6330541J12Rik, AW546131
Definition
(RefSeq) glycosylphosphatidylinositol specific phospholipase D1
  KO
K01127  glycosylphosphatidylinositol phospholipase D [EC:3.1.4.50]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    14756 (Gpld1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.50  glycosylphosphatidylinositol phospholipase D
     14756 (Gpld1)
SSDB
Motif
Pfam: FG-GAP Zn_dep_PLPC VCBS
Other DBs
NCBI-GeneID: 14756
NCBI-ProteinID: NP_032182
MGI: 106604
Ensembl: ENSMUSG00000021340
Vega: OTTMUSG00000000734
UniProt: Q8VCU2 Q8R432
Position
13 A3.1; 13 10.79 cM
AA seq 842 aa
MSAGRLWSSLLLLLPLFCSKSSSCGLSTHVEIGHRALEFLRLQDGRINYKELILEHQDAY
QAGTVFPDAFYPSICKRGKYHDVSERTHWTPFLNASIHYIRENYPLPWEKDTEKLVAFLF
GITSHMVADVSWHSLGIEQGFLRTMGAIDFYNSYSDAHSAGDFGGDVLSQFEFNFNYLSR
RWYVPVRDLLRIYDNLYGRKVITKDVLVDCTYLQFLEMHGEMFAVSKLYSTYSTKSPFLV
EQFQDYFLGGLDDMAFWSTNIYRLTSFMLENGTSDCNLPENPLFISCDGRNHTLSGSKVQ
KNDFHRNLTMFISRDIRKNLNYTERGVFYSTGSWAPESVTFMYQTLERNLRLMLAGSSQK
NLNHVSSPSASYTLSVPYARLGWVMTSADLNQDGHGDLVVGAPGYSHPGRFQIGRVYIIY
GNDLGLPPIDLDLDKEAHGILEGFQPSGRFGSALAVLDFNQDGLPDLAVGAPSVGSGQLT
YNGSVYVYYGSQQGRLSSSPNVTISCKDTYCNLGWTLLATDADGDGRHDLVISSPFAPGG
GKQRGIVATFYSHPRRNDKELLTLEEADWKVNGEEDFSWFGYSLHGVTVANRSLLLIGSP
TWKNVSRMARSSHKKNQEEKSLGKVYGYFLPNRQSTITISGDKAMGKLGTSLSSGYVRVN
GTLTQVLLVGAPTHDDVSKMAFLTMTLHQGGATRMYELAPEKTQPALLSTFSGDRRFSRF
GSVLHLTDLDDDGLDEIIMAAPLRITDVTSGLLGGEDGRVYIYNGMYTTLGDMTGKCKSW
MTPCPEEKAQYVLTSPEASSRFGSSLVSVRSKGRNQVVVAAGRSSWGARLSGALHVYSFS
SD
NT seq 2529 nt   +upstreamnt  +downstreamnt
atgtctgcaggcaggctgtggtctagcctgctgcttctgctgcctcttttctgctctaaa
agctcatcttgtggtctctcaacacatgtagaaataggacacagggctctggagtttctt
cggcttcaagatggacgcattaactacaaagagctgatcttagagcaccaggacgcatat
caggctgggaccgtgtttcctgatgccttttatcctagcatctgcaaaagaggaaaatat
catgacgtttctgagaggactcactggactccatttcttaacgccagcatccattatatt
cgagagaactaccctctgccctgggagaaggacacagagaagttggtggctttcttgttt
ggaatcacctcccacatggtcgctgacgtgagctggcatagcctgggtattgaacaaggg
ttcctcaggacaatgggagctatcgatttttacaactcttactctgacgctcactcggct
ggtgattttggaggagatgtgttgagccagtttgaatttaattttaattacctctcacgg
cgctggtacgtgcccgtcagggatcttctgagaatttatgataatctctatggtcggaaa
gtcatcaccaaagacgtccttgttgattgcacctaccttcagttcctggaaatgcacggg
gagatgtttgctgtttccaagctctattccacgtactctacaaagtccccatttctggtg
gagcagttccaagactatttcctcggaggtctggatgacatggcattctggtccacgaac
atttaccgtttgaccagctttatgctggagaacgggaccagtgactgcaacctgcctgag
aaccccctgttcatctcctgtgatggcaggaaccacaccctcagtggctcaaaagtgcag
aaaaatgattttcacaggaatttgaccatgttcataagtagagacatcaggaaaaacctc
aattacacagaaagaggcgtgttctacagcacaggctcctgggccccggaatctgtcacc
tttatgtaccagactctggagaggaacctgaggctgatgcttgctggcagctctcagaaa
aatctgaatcatgtctccagcccctctgcctcctacaccctgtctgtcccctatgccagg
ctcggctgggtcatgacctcagctgacctcaaccaggatgggcacggagacctcgtggtg
ggtgcaccaggctacagccaccctggccgcttccagattgggcgggtgtacatcatctat
ggcaacgatctgggcctgcctcccatcgacctggacttagacaaggaggcccatgggatc
ctggagggcttccagccttcaggtcgctttggctcagctttggccgtgctggacttcaac
caggatgggctgcctgacctggctgtgggcgctccctccgtgggctcagggcagctcacc
tacaatggctcggtgtatgtctactatggttcccagcaagggaggctgtcttcttcccct
aacgtcaccatctcctgcaaggacacctactgtaacttgggctggaccctcttggcaaca
gatgcagacggagatggccggcacgatctggtcatcagctcccctttcgcaccaggtgga
gggaagcagagaggaattgtggccaccttttattctcaccccagacggaatgacaaagaa
ttactgactttggaggaagctgactggaaggtgaatggggaggaggacttctcgtggttt
ggatactcccttcacggggtcacagtggcaaacagaagcctgctgctgattgggagcccg
acctggaagaatgtcagcaggatggcacgctcaagccacaaaaagaaccaagaggaaaag
agcctgggaaaggtgtacggctactttctcccgaaccgccagagcacaatcactatctcg
ggagataaggcgatgggaaagctgggtacctccctgtccagtggttatgtgagagtgaat
gggaccctaacccaagtcctgctggttggagcccctactcatgatgacgtgtctaaaatg
gcattcctaaccatgaccctgcaccagggtggagccactcggatgtacgaactagctccc
gagaagacacagcctgctctgctcagcacattcagtggagaccgacgcttttctcgattt
ggtagtgttctgcacctgactgacctggatgatgatggcttagatgaaatcatcatggct
gccccactgaggataacagatgtcacttccggactgctagggggagaagatgggcgagtg
tacatttataatggcatgtataccaccttaggtgacatgaccggcaaatgcaagtcctgg
atgactccatgtccggaggagaaggcacagtatgtactaacttctccagaggcaagttca
aggtttgggagctcgctggtgtccgtgcggtctaagggaaggaaccaagtggttgttgct
gctggaaggagttcttggggagcccggctctctggggcacttcatgtctacagcttcagc
tcagactaa

DBGET integrated database retrieval system