KEGG   Mus musculus (mouse): 14766Help
Entry
14766             CDS       T01002                                 

Gene name
Adgrg1, Cyt28, Gpr56, TM7LN4, TM7XN1
Definition
(RefSeq) adhesion G protein-coupled receptor G1
  KO
K08450  adhesion G-protein coupled receptor G1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    14766 (Adgrg1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    14766 (Adgrg1)
Peptidases and inhibitors [BR:mmu01002]
 Mixed peptidases
  Family P2
   14766 (Adgrg1)
G protein-coupled receptors [BR:mmu04030]
 Adhesion receptor family
  Others
   14766 (Adgrg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLL 7tm_2 GAIN_A GPS
Motif
Other DBs
NCBI-GeneID: 14766
NCBI-ProteinID: NP_001185823
MGI: 1340051
Ensembl: ENSMUSG00000031785
Vega: OTTMUSG00000061709
UniProt: Q8K209
Structure
PDB: 

Position
8 C5; 8 47.12 cM
AA seq 687 aa AA seqDB search
MAVQVLRQMVYFLLSLFSLVQGAHSGSPREDFRFCGQRNQTQQSTLHYDQSSEPHIFVWN
TEETLTIRAPFLAAPDIPRFFPEPRGLYHFCLYWSRHTGRLHLRYGKHDYLLSSQASRLL
CFQKQEQSLKQGAPLIATSVSSWQIPQNTSLPGAPSFIFSFHNAPHKVSHNASVDMCDLK
KELQQLSRYLQHPQKAAKRPTAAFISQQLQSLESKLTSVSFLGDTLSFEEDRVNATVWKL
PPTAGLEDLHIHSQKEEEQSEVQAYSLLLPRAVFQQTRGRRRDDAKRLLVVDFSSQALFQ
DKNSSQVLGEKVLGIVVQNTKVTNLSDPVVLTFQHQPQPKNVTLQCVFWVEDPASSSTGS
WSSAGCETVSRDTQTSCLCNHLTYFAVLMVSSTEVEATHKHYLTLLSYVGCVISALACVF
TIAAYLCSRRKSRDYTIKVHMNLLSAVFLLDVSFLLSEPVALTGSEAACRTSAMFLHFSL
LACLSWMGLEGYNLYRLVVEVFGTYVPGYLLKLSIVGWGFPVFLVTLVALVDVNNYGPII
LAVRRTPERVTYPSMCWIRDSLVSYVTNLGLFSLVFLFNLAMLATMVVQILRLRPHSQNW
PHVLTLLGLSLVLGLPWALVFFSFASGTFQLVILYLFSIITSFQGFLIFLWYWSMRFQAQ
GGPSPLKNNSDSAKLPISSGSTSSSRI
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggctgtccaggtgctgcggcagatggtctacttcctactgagtctgttttctctggtg
caaggtgcacacagtggcagcccccgagaagacttccgcttctgtggccagcggaaccag
acccaacagagcaccctccactatgatcaatcttcagagcctcacatctttgtgtggaac
acagaggagaccctcacaattcgtgcccccttcctggcagccccagatattccccgcttc
ttcccagagcctagagggctctatcacttctgcctctactggagtcgccacactgggaga
ctccacttgcgctatggcaagcatgactacctgcttagtagccaagcctccagactcctc
tgcttccagaaacaggagcagagcctgaagcagggagccccgctgatcgccacctctgtc
agctcctggcagattccccagaacaccagcctgcctggggctccgagcttcatcttctcc
ttccacaatgccccacacaaggtctcccacaatgcatctgtggacatgtgtgatctcaag
aaggaattgcagcagcttagcaggtacctgcagcaccctcaaaaggctgccaagcggccc
accgcagcgttcatcagccagcagttacagagcctggagtcaaagctgacctctgtgagc
ttcctgggagacacattatcctttgaggaggaccgggtcaatgctacagtgtggaagctg
ccacccacagccggtctagaggatctgcatatccactcccagaaggaggaggagcagagt
gaggtccaggcatactcgctgttgcttccccgggccgtattccagcagaccagaggccgt
cgccgggatgacgccaagaggctcctggtagtagacttcagcagccaagctttgttccag
gacaagaattctagccaagtcctgggtgagaaggtcttgggtattgtcgtgcagaacacc
aaagtcaccaacctctcagatccggtggtactcaccttccagcaccagcctcagccaaaa
aatgtgactctgcagtgcgtgttctgggttgaagacccggcatcaagcagcacagggagc
tggagcagtgcaggctgcgagacagtgagcagagacacacagacatcctgcctgtgcaac
cacctgacctactttgcagtgctgatggtgtcatccacagaggtagaagccactcacaaa
cactacctcacgctcctgtcctacgtgggctgtgtcatctctgctctggcttgtgtcttc
actattgctgcctacctctgctccaggaggaagtcacgtgactacaccatcaaagtccac
atgaacctgctgtccgctgtcttcctgctggacgtgagcttcctgctcagcgagcctgtg
gcactgacgggctccgaagcagcctgtcgcaccagtgccatgttcctgcacttctccctg
cttgcctgcctctcctggatgggcctcgagggctacaatctctaccgactggtggtggag
gtcttcggtacctatgtgcccggctatctgctcaagctgagcatcgtgggctggggtttt
cctgtcttcctggtcactctggtggcgttggtggatgtgaataactacggccccattatc
ctagctgtgcgccggactccggaacgtgtcacctacccctctatgtgctggatccgggac
tccctggtgagctatgtcaccaacctgggcctcttcagtctggtgttcctgttcaacctg
gctatgctggccaccatggtggtgcagatcctgcggcttcgcccgcacagccagaactgg
ccccacgtgctgaccctgctgggcctcagcctggtccttggcctcccctgggccttggtc
ttcttttcctttgcttccggcaccttccagcttgtcatcctctacctcttcagcatcata
acttccttccaaggcttcctcatcttcctgtggtactggtccatgcggttccaggcccaa
ggcggcccctcccctctgaagaacaactcagacagcgccaaactccccatcagctccggc
agcacctcctccagccgcatctaa

DBGET integrated database retrieval system